KEGG   Homo sapiens (human): 9088Help
Entry
9088              CDS       T01001                                 

Gene name
PKMYT1, MYT1, PPP1R126
Definition
(RefSeq) protein kinase, membrane associated tyrosine/threonine 1
  KO
K06633  membrane-associated tyrosine- and threonine-specific cdc2-inhibitory kinase [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04110  Cell cycle
hsa04114  Oocyte meiosis
hsa04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    9088 (PKMYT1)
   04114 Oocyte meiosis
    9088 (PKMYT1)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    9088 (PKMYT1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    9088 (PKMYT1)
   01009 Protein phosphatases and associated proteins [BR:hsa01009]
    9088 (PKMYT1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     9088 (PKMYT1)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: Other
  WEE family
   9088 (PKMYT1)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     9088 (PKMYT1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like
Motif
Other DBs
NCBI-GeneID: 9088
NCBI-ProteinID: NP_004194
OMIM: 602474
HGNC: 29650
Ensembl: ENSG00000127564
Vega: OTTHUMG00000128975
Pharos: Q99640(Tchem)
UniProt: Q99640 Q0IJ49
Structure
PDB: 

Position
16p13.3
AA seq 499 aa AA seqDB search
MLERPPALAMPMPTEGTPPPLSGTPIPVPAYFRHAEPGFSLKRPRGLSRSLPPPPPAKGS
IPISRLFPPRTPGWHQLQPRRVSFRGEASETLQSPGYDPSRPESFFQQSFQRLSRLGHGS
YGEVFKVRSKEDGRLYAVKRSMSPFRGPKDRARKLAEVGSHEKVGQHPCCVRLEQAWEEG
GILYLQTELCGPSLQQHCEAWGASLPEAQVWGYLRDTLLALAHLHSQGLVHLDVKPANIF
LGPRGRCKLGDFGLLVELGTAGAGEVQEGDPRYMAPELLQGSYGTAADVFSLGLTILEVA
CNMELPHGGEGWQQLRQGYLPPEFTAGLSSELRSVLVMMLEPDPKLRATAEALLALPVLR
QPRAWGVLWCMAAEALSRGWALWQALLALLCWLWHGLAHPASWLQPLGPPATPPGSPPCS
LLLDSSLSSNWDDDSLGPSLSPEAVLARTVGSTSTPRSRCTPRDALDLSDINSEPPRGSF
PSFEPRNLLSLFEDTLDPT
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgctagaacggcctcctgcactggccatgcccatgcccacggagggcaccccgccacct
ctgagtggcacccccatcccagtcccagcctacttccgccacgcagaacctggattctcc
ctcaagaggcccagggggctcagccggagcctcccacctccgccccctgccaagggcagc
attcccatcagccgcctcttccctcctcggaccccaggctggcaccagctgcagccccgg
cgggtgtcattccggggcgaggcctcagagactctgcagagccctgggtatgacccaagc
cggccagagtccttcttccagcagagcttccagaggctcagccgcctgggccatggctcc
tacggagaggtcttcaaggtgcgctccaaggaggacggccggctctatgcggtaaagcgt
tccatgtcaccattccggggccccaaggaccgggcccgcaagttggccgaggtgggcagc
cacgagaaggtggggcagcacccatgctgcgtgcggctggagcaggcctgggaggagggc
ggcatcctgtacctgcagacggagctgtgcgggcccagcctgcagcaacactgtgaggcc
tggggtgccagcctgcctgaggcccaggtctggggctacctgcgggacacgctgcttgcc
ctggcccatctgcacagccagggcctggtgcaccttgatgtcaagcctgccaacatcttc
ctggggccccggggccgctgcaagctgggtgacttcggactgctggtggagctgggtaca
gcaggagctggtgaggtccaggagggagacccccgctacatggcccccgagctgctgcag
ggctcctatgggacagcagcggatgtgttcagtctgggcctcaccatcctggaagtggca
tgcaacatggagctgccccacggtggggagggctggcagcagctgcgccagggctacctg
ccccctgagttcactgccggtctgtcttccgagctgcgttctgtccttgtcatgatgctg
gagccagaccccaagctgcgggccacggccgaggccctgctggcactgcctgtgttgagg
cagccgcgggcctggggtgtgctgtggtgcatggcagcggaggccctgagccgagggtgg
gccctgtggcaggccctgcttgccctgctctgctggctctggcatgggctggctcaccct
gccagctggctacagcccctgggcccgccagccaccccgcctggctcaccaccctgcagt
ttgctcctggacagcagcctctccagcaactgggatgacgacagcctagggccttcactc
tcccctgaggctgtcctggcccggactgtggggagcacctccaccccccggagcaggtgc
acacccagggatgccctggacctaagtgacatcaactcagagcctcctcggggctccttc
ccctcctttgagcctcggaacctcctcagcctgtttgaggacaccctagacccaacctga

DBGET integrated database retrieval system