KEGG   Homo sapiens (human): 909Help
Entry
909               CDS       T01001                                 

Gene name
CD1A, CD1, FCB6, HTA1, R4, T6
Definition
(RefSeq) CD1a molecule
  KO
K06448  T-cell surface glycoprotein CD1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04530  Tight junction
hsa04640  Hematopoietic cell lineage
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    909 (CD1A)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    909 (CD1A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:hsa04090]
    909 (CD1A)
CD molecules [BR:hsa04090]
 Proteins
  909 (CD1A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MHC_I_3 C1-set MHC_I Ig_3
Motif
Other DBs
NCBI-GeneID: 909
NCBI-ProteinID: NP_001754
OMIM: 188370
HGNC: 1634
Ensembl: ENSG00000158477
Vega: OTTHUMG00000017512
Pharos: P06126(Tbio)
UniProt: P06126
Structure
PDB: 

Position
1q23.1
AA seq 327 aa AA seqDB search
MLFLLLPLLAVLPGDGNADGLKEPLSFHVTWIASFYNHSWKQNLVSGWLSDLQTHTWDSN
SSTIVFLCPWSRGNFSNEEWKELETLFRIRTIRSFEGIRRYAHELQFEYPFEIQVTGGCE
LHSGKVSGSFLQLAYQGSDFVSFQNNSWLPYPVAGNMAKHFCKVLNQNQHENDITHNLLS
DTCPRFILGLLDAGKAHLQRQVKPEAWLSHGPSPGPGHLQLVCHVSGFYPKPVWVMWMRG
EQEQQGTQRGDILPSADGTWYLRATLEVAAGEAADLSCRVKHSSLEGQDIVLYWEHHSSV
GFIILAVIVPLLLLIGLALWFRKRCFC
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgctgtttttgctacttccattgttagctgttctcccaggtgatggcaatgcagacggg
ctcaaggagcctctctccttccatgtcacctggatcgcatccttttacaaccattcctgg
aaacaaaatctggtctcaggttggctgagtgatttgcagactcatacctgggacagcaat
tccagcaccatcgttttcctgtgcccctggtccaggggaaacttcagcaatgaggagtgg
aaggaactggaaacattattccgtatacgcaccattcggtcatttgagggaattcgtaga
tacgcccatgaattgcagtttgaatatccttttgagatacaggtgacaggaggctgtgag
ctgcactctggaaaggtctcaggaagcttcttgcagttagcttatcaaggatcagacttt
gtgagcttccagaacaattcatggttgccatatccagtggctgggaatatggccaagcat
ttctgcaaagtgctcaatcagaatcagcatgaaaatgacataacacacaatcttctcagt
gacacctgcccacgtttcatcttgggtcttcttgatgcaggaaaggcacatctccagcgg
caagtgaagcccgaggcctggctgtcccatggccccagtcctggccctggccatctgcag
cttgtgtgccatgtctcaggattctacccaaagcccgtgtgggtgatgtggatgcggggt
gagcaggagcagcagggcactcagcgaggggacatcttgcccagtgctgatgggacatgg
tatctccgcgcaaccctggaggtggccgctggggaggcagctgacctgtcctgtcgggtg
aagcacagcagtctagagggccaggacatcgtcctctactgggagcatcacagttccgtg
ggcttcatcatcttggcggtgatagtgcctttacttcttctgataggtcttgcgctttgg
ttcaggaaacgctgtttctgttaa

DBGET integrated database retrieval system