KEGG   Homo sapiens (human): 909Help
Entry
909               CDS       T01001                                 

Gene name
CD1A, CD1, FCB6, HTA1, R4, T6
Definition
(RefSeq) CD1a molecule
  KO
K06448  T-cell surface glycoprotein CD1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04530  Tight junction
hsa04640  Hematopoietic cell lineage
hsa05146  Amoebiasis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    909 (CD1A)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    909 (CD1A)
 09160 Human Diseases
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    909 (CD1A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:hsa04090]
    909 (CD1A)
CD molecules [BR:hsa04090]
 Proteins
  909 (CD1A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MHC_I_3 C1-set MHC_I Ig_3
Motif
Other DBs
NCBI-GeneID: 909
NCBI-ProteinID: NP_001754
OMIM: 188370
HGNC: 1634
Ensembl: ENSG00000158477
Vega: OTTHUMG00000017512
Pharos: P06126(Tbio)
UniProt: P06126
Structure
PDB: 

Position
1q23.1
AA seq 327 aa AA seqDB search
MLFLLLPLLAVLPGDGNADGLKEPLSFHVTWIASFYNHSWKQNLVSGWLSDLQTHTWDSN
SSTIVFLCPWSRGNFSNEEWKELETLFRIRTIRSFEGIRRYAHELQFEYPFEIQVTGGCE
LHSGKVSGSFLQLAYQGSDFVSFQNNSWLPYPVAGNMAKHFCKVLNQNQHENDITHNLLS
DTCPRFILGLLDAGKAHLQRQVKPEAWLSHGPSPGPGHLQLVCHVSGFYPKPVWVMWMRG
EQEQQGTQRGDILPSADGTWYLRATLEVAAGEAADLSCRVKHSSLEGQDIVLYWEHHSSV
GFIILAVIVPLLLLIGLALWFRKRCFC
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgctgtttttgctacttccattgttagctgttctcccaggtgatggcaatgcagacggg
ctcaaggagcctctctccttccatgtcacctggatcgcatccttttacaaccattcctgg
aaacaaaatctggtctcaggttggctgagtgatttgcagactcatacctgggacagcaat
tccagcaccatcgttttcctgtgcccctggtccaggggaaacttcagcaatgaggagtgg
aaggaactggaaacattattccgtatacgcaccattcggtcatttgagggaattcgtaga
tacgcccatgaattgcagtttgaatatccttttgagatacaggtgacaggaggctgtgag
ctgcactctggaaaggtctcaggaagcttcttgcagttagcttatcaaggatcagacttt
gtgagcttccagaacaattcatggttgccatatccagtggctgggaatatggccaagcat
ttctgcaaagtgctcaatcagaatcagcatgaaaatgacataacacacaatcttctcagt
gacacctgcccacgtttcatcttgggtcttcttgatgcaggaaaggcacatctccagcgg
caagtgaagcccgaggcctggctgtcccatggccccagtcctggccctggccatctgcag
cttgtgtgccatgtctcaggattctacccaaagcccgtgtgggtgatgtggatgcggggt
gagcaggagcagcagggcactcagcgaggggacatcttgcccagtgctgatgggacatgg
tatctccgcgcaaccctggaggtggccgctggggaggcagctgacctgtcctgtcgggtg
aagcacagcagtctagagggccaggacatcgtcctctactgggagcatcacagttccgtg
ggcttcatcatcttggcggtgatagtgcctttacttcttctgataggtcttgcgctttgg
ttcaggaaacgctgtttctgttaa

KEGG   Homo sapiens (human): 910Help
Entry
910               CDS       T01001                                 

Gene name
CD1B, CD1, CD1A, R1
Definition
(RefSeq) CD1b molecule
  KO
K06448  T-cell surface glycoprotein CD1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04530  Tight junction
hsa04640  Hematopoietic cell lineage
hsa05146  Amoebiasis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    910 (CD1B)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    910 (CD1B)
 09160 Human Diseases
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    910 (CD1B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:hsa04090]
    910 (CD1B)
CD molecules [BR:hsa04090]
 Proteins
  910 (CD1B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MHC_I_3 C1-set MHC_I Ig_3 DUF3377 MLANA
Motif
Other DBs
NCBI-GeneID: 910
NCBI-ProteinID: NP_001755
OMIM: 188360
HGNC: 1635
Ensembl: ENSG00000158485
Vega: OTTHUMG00000017513
Pharos: P29016(Tbio)
UniProt: P29016
Structure
PDB: 

Position
1q23.1
AA seq 333 aa AA seqDB search
MLLLPFQLLAVLFPGGNSEHAFQGPTSFHVIQTSSFTNSTWAQTQGSGWLDDLQIHGWDS
DSGTAIFLKPWSKGNFSDKEVAELEEIFRVYIFGFAREVQDFAGDFQMKYPFEIQGIAGC
ELHSGGAIVSFLRGALGGLDFLSVKNASCVPSPEGGSRAQKFCALIIQYQGIMETVRILL
YETCPRYLLGVLNAGKADLQRQVKPEAWLSSGPSPGPGRLQLVCHVSGFYPKPVWVMWMR
GEQEQQGTQLGDILPNANWTWYLRATLDVADGEAAGLSCRVKHSSLEGQDIILYWRNPTS
IGSIVLAIIVPSLLLLLCLALWYMRRRSYQNIP
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgctgctgctgccatttcaactgttagctgttctctttcctggtggtaacagtgaacat
gccttccaggggccgacctcctttcatgttatccagacctcgtcctttaccaatagtacc
tgggcacaaactcaaggctcaggctggttggatgatttgcagattcatggctgggatagc
gactcaggcactgccatattcctgaagccttggtctaaaggtaactttagtgataaggag
gttgctgagttagaggagatattccgagtctacatctttggattcgctcgagaagtacaa
gactttgccggtgatttccagatgaaatacccctttgagatccagggcatagcaggctgt
gagctacattctggaggtgccatagtaagcttcctgaggggagctctaggaggattggat
ttcctgagtgtcaagaatgcttcatgtgtgccttccccagaaggtggcagcagggcacag
aaattctgtgcactaatcatacaatatcaaggtatcatggaaactgtgagaattctcctc
tatgaaacctgcccccgatatctcttgggcgtcctcaatgcaggaaaagcagatctgcaa
agacaagtgaagcctgaggcctggctgtccagtggccccagtcctggacctggccgtctg
cagcttgtgtgccatgtctcaggattctacccaaagcccgtgtgggtgatgtggatgcgg
ggtgagcaggagcagcagggcactcagctaggggacatcctgcccaatgctaactggaca
tggtatctccgagcaaccctggatgtggcagatggggaggcggctggcctgtcctgtcgg
gtgaagcacagcagtttagagggccaggacatcatcctctactggagaaaccccacctcc
attggctcaattgttttggcaataatagtgccttccttgctccttttgctatgccttgca
ttatggtatatgaggcgccggtcatatcagaatatcccatga

KEGG   Homo sapiens (human): 911Help
Entry
911               CDS       T01001                                 

Gene name
CD1C, BDCA1, CD1, CD1A, R7
Definition
(RefSeq) CD1c molecule
  KO
K06448  T-cell surface glycoprotein CD1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04530  Tight junction
hsa04640  Hematopoietic cell lineage
hsa05146  Amoebiasis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    911 (CD1C)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    911 (CD1C)
 09160 Human Diseases
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    911 (CD1C)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:hsa04090]
    911 (CD1C)
CD molecules [BR:hsa04090]
 Proteins
  911 (CD1C)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MHC_I_3 C1-set MHC_I Ig_3 Flp1_like
Motif
Other DBs
NCBI-GeneID: 911
NCBI-ProteinID: NP_001756
OMIM: 188340
HGNC: 1636
Ensembl: ENSG00000158481
Vega: OTTHUMG00000017514
Pharos: P29017(Tbio)
UniProt: P29017
Structure
PDB: 

Position
1q23.1
AA seq 333 aa AA seqDB search
MLFLQFLLLALLLPGGDNADASQEHVSFHVIQIFSFVNQSWARGQGSGWLDELQTHGWDS
ESGTIIFLHNWSKGNFSNEELSDLELLFRFYLFGLTREIQDHASQDYSKYPFEVQVKAGC
ELHSGKSPEGFFQVAFNGLDLLSFQNTTWVPSPGCGSLAQSVCHLLNHQYEGVTETVYNL
IRSTCPRFLLGLLDAGKMYVHRQVRPEAWLSSRPSLGSGQLLLVCHASGFYPKPVWVTWM
RNEQEQLGTKHGDILPNADGTWYLQVILEVASEEPAGLSCRVRHSSLGGQDIILYWGHHF
SMNWIALVVIVPLVILIVLVLWFKKHCSYQDIL
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgctgtttctgcagtttctgctgctagctcttcttctcccaggtggtgacaatgcagac
gcatcccaggaacacgtctccttccatgtcatccagatcttctcatttgtcaaccaatcc
tgggcacgaggtcagggctcaggatggctggacgagttgcagactcatggctgggacagt
gaatcaggcacaataattttcctgcataactggtccaagggcaacttcagcaatgaagag
ttgtcagacctagagttgttatttcgtttctacctctttggattaactcgggagattcaa
gaccatgcaagtcaagattactcgaaatatccctttgaagtacaggtgaaagcgggctgt
gagctgcattctggaaagagcccagaaggcttctttcaggtagctttcaacggattagat
ttactgagtttccagaatacaacatgggtgccatctccaggctgtggaagtttggcccaa
agtgtctgtcatctactcaatcatcagtatgaaggcgtcacagaaacagtgtataatctc
ataagaagcacttgcccccgatttctcttgggtctcctggatgcagggaagatgtatgta
cacaggcaagtgaggccagaagcctggctgtccagtcgccccagccttgggtctggccag
ctgttgctggtttgtcatgcctccggcttctacccaaagcctgtttgggtgacatggatg
cggaatgaacaggagcaactgggcactaaacatggtgatattcttcctaatgctgatggg
acatggtatcttcaggtgatcctggaggtggcatctgaggagcctgctggcctgtcttgt
cgagtgagacacagcagtctaggaggccaggacatcatcctctactggggacaccacttt
tccatgaattggattgccttggtagtgatagtgcccttggtgattctaatagtccttgtg
ttatggtttaagaagcactgctcatatcaggacatcctgtga

KEGG   Homo sapiens (human): 912Help
Entry
912               CDS       T01001                                 

Gene name
CD1D, CD1A, R3, R3G1
Definition
(RefSeq) CD1d molecule
  KO
K06448  T-cell surface glycoprotein CD1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04530  Tight junction
hsa04640  Hematopoietic cell lineage
hsa05146  Amoebiasis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    912 (CD1D)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    912 (CD1D)
 09160 Human Diseases
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    912 (CD1D)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:hsa04090]
    912 (CD1D)
CD molecules [BR:hsa04090]
 Proteins
  912 (CD1D)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MHC_I_3 C1-set MHC_I Ig_3 Kelch_2
Motif
Other DBs
NCBI-GeneID: 912
NCBI-ProteinID: NP_001757
OMIM: 188410
HGNC: 1637
Ensembl: ENSG00000158473
Vega: OTTHUMG00000022436
Pharos: P15813(Tbio)
UniProt: P15813
Structure
PDB: 

Position
1q23.1
AA seq 335 aa AA seqDB search
MGCLLFLLLWALLQAWGSAEVPQRLFPLRCLQISSFANSSWTRTDGLAWLGELQTHSWSN
DSDTVRSLKPWSQGTFSDQQWETLQHIFRVYRSSFTRDVKEFAKMLRLSYPLELQVSAGC
EVHPGNASNNFFHVAFQGKDILSFQGTSWEPTQEAPLWVNLAIQVLNQDKWTRETVQWLL
NGTCPQFVSGLLESGKSELKKQVKPKAWLSRGPSPGPGRLLLVCHVSGFYPKPVWVKWMR
GEQEQQGTQPGDILPNADETWYLRATLDVVAGEAAGLSCRVKHSSLEGQDIVLYWGGSYT
SMGLIALAVLACLLFLLIVGFTSRFKRQTSYQGVL
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atggggtgcctgctgtttctgctgctctgggcgctcctccaggcttggggaagcgctgaa
gtcccgcaaaggcttttccccctccgctgcctccagatctcgtccttcgccaatagcagc
tggacgcgcaccgacggcttggcgtggctgggggagctgcagacgcacagctggagcaac
gactcggacaccgtccgctctctgaagccttggtcccagggcacgttcagcgaccagcag
tgggagacgctgcagcatatatttcgggtttatcgaagcagcttcaccagggacgtgaag
gaattcgccaaaatgctacgcttatcctatcccttggagctccaggtgtccgctggctgt
gaggtgcaccctgggaacgcctcaaataacttcttccatgtagcatttcaaggaaaagat
atcctgagtttccaaggaacttcttgggagccaacccaagaggccccactttgggtaaac
ttggccattcaagtgctcaaccaggacaagtggacgagggaaacagtgcagtggctcctt
aatggcacctgcccccaatttgtcagtggcctccttgagtcagggaagtcggaactgaag
aagcaagtgaagcccaaggcctggctgtcccgtggccccagtcctggccctggccgtctg
ctgctggtgtgccatgtctcaggattctacccaaagcctgtatgggtgaagtggatgcgg
ggtgagcaggagcagcagggcactcagccaggggacatcctgcccaatgctgacgagaca
tggtatctccgagcaaccctggatgtggtggctggggaggcagctggcctgtcctgtcgg
gtgaagcacagcagtctagagggccaggacatcgtcctctactggggtgggagctacacc
tccatgggcttgattgccttggcagtcctggcgtgcttgctgttcctcctcattgtgggc
tttacctcccggtttaagaggcaaacttcctatcagggcgtcctgtga

KEGG   Homo sapiens (human): 913Help
Entry
913               CDS       T01001                                 

Gene name
CD1E, CD1A, R2
Definition
(RefSeq) CD1e molecule
  KO
K06448  T-cell surface glycoprotein CD1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04530  Tight junction
hsa04640  Hematopoietic cell lineage
hsa05146  Amoebiasis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    913 (CD1E)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    913 (CD1E)
 09160 Human Diseases
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    913 (CD1E)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:hsa04090]
    913 (CD1E)
CD molecules [BR:hsa04090]
 Proteins
  913 (CD1E)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MHC_I_3 C1-set Ig_3 Wzy_C MHC_I
Motif
Other DBs
NCBI-GeneID: 913
NCBI-ProteinID: NP_112155
OMIM: 188411
HGNC: 1638
Ensembl: ENSG00000158488
Vega: OTTHUMG00000017515
Pharos: P15812(Tbio)
UniProt: P15812 A2RRL5
Structure
PDB: 

Position
1q23.1
AA seq 388 aa AA seqDB search
MLLLFLLFEGLCCPGENTAAPQALQSYHLAAEEQLSFRMLQTSSFANHSWAHSEGSGWLG
DLQTHGWDTVLGTIRFLKPWSHGNFSKQELKNLQSLFQLYFHSFIQIVQASAGQFQLEYP
FEIQILAGCRMNAPQIFLNMAYQGSDFLSFQGISWEPSPGAGIRAQNICKVLNRYLDIKE
ILQSLLGHTCPRFLAGLMEAGESELKRKVKPEAWLSCGPSPGPGRLQLVCHVSGFYPKPV
WVMWMRGEQEQRGTQRGDVLPNADETWYLRATLDVAAGEAAGLSCRVKHSSLGGHDLIIH
WGGYSIFLILICLTVIVTLVILVVVDSRLKKQSSNKNILSPHTPSPVFLMGANTQDTKNS
RHQFCLAQVSWIKNRVLKKWKTRLNQLW
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgctgctcctgttcctcctcttcgagggtctctgctgtcctggggaaaatacagcagct
ccccaggctctacaatcctatcatctagcagcagaggagcagctgtccttccgcatgctc
caaacttcctcctttgccaaccacagctgggcacacagtgagggctcaggatggctgggt
gacctgcagactcatggctgggacactgtcttgggcaccatccgctttctgaagccctgg
tcccatggaaacttcagcaagcaggagctgaaaaacttacagtcactgttccagttatac
ttccatagttttatccagatagtgcaagcttctgctggtcaatttcagcttgaatacccc
ttcgagatccagatattagctggctgtagaatgaatgccccacaaatcttcttaaatatg
gcatatcaagggtcagatttcctgagtttccaaggaatttcctgggagccatctccagga
gcagggatccgggcccagaacatctgtaaagtgctcaatcgctacctagatattaaggaa
atactgcaaagccttcttggtcacacctgccctcgatttctagcggggctcatggaagca
ggggagtcagaactgaaacggaaagtgaagccagaggcctggctgtcctgtggccccagt
cctggccctggccgtctgcagcttgtgtgccatgtctcaggattctacccaaagcccgtg
tgggtgatgtggatgcggggtgagcaggagcagcggggcactcagcgaggggacgtcctg
cctaatgctgacgagacatggtatctccgagcaaccctggatgtggcggctggggaggca
gctggcctgtcctgtcgggtgaaacacagcagtctagggggccatgatctaatcatccat
tggggtggatattccatctttctcatcctgatctgtttgactgtgatagttaccctggtc
atattggttgtagttgactcacggttaaaaaaacagagttcaaataagaacattctttct
ccccacacacccagccctgtctttctcatgggagccaacactcaggacaccaagaattca
agacatcagttctgcttggcacaagtatcgtggatcaaaaacagagtattgaagaagtgg
aagacacgcctaaaccaactctggtga

DBGET integrated database retrieval system