KEGG   Homo sapiens (human): 9092Help
Entry
9092              CDS       T01001                                 

Gene name
SART1, Ara1, HAF, HOMS1, SART1259, SNRNP110, Snu66
Definition
(RefSeq) spliceosome associated factor 1, recruiter of U4/U6.U5 tri-snRNP
  KO
K11984  U4/U6.U5 tri-snRNP-associated protein 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    9092 (SART1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:hsa03041]
    9092 (SART1)
   04121 Ubiquitin system [BR:hsa04121]
    9092 (SART1)
Spliceosome [BR:hsa03041]
 Complex B
  U4/U6.U5 tri-snRNP components
   U4/U6.U5 tri-snRNP specific factors
    9092 (SART1)
 Complex C
   U4/U6.U5 tri-SnRNP specific factors
    9092 (SART1)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    9092 (SART1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SART-1
Motif
Other DBs
NCBI-GeneID: 9092
NCBI-ProteinID: NP_005137
OMIM: 605941
HGNC: 10538
Ensembl: ENSG00000175467
Vega: OTTHUMG00000166771
Pharos: O43290(Tbio)
UniProt: O43290
Structure
PDB: 

Position
11q13.1
AA seq 800 aa AA seqDB search
MGSSKKHRGEKEAAGTTAAAGTGGATEQPPRHREHKKHKHRSGGSGGSGGERRKRSRERG
GERGSGRRGAEAEARSSTHGRERSQAEPSERRVKREKRDDGYEAAASSKTSSGDASSLSI
EETNKLRAKLGLKPLEVNAIKKEAGTKEEPVTADVINPMALRQREELREKLAAAKEKRLL
NQKLGKIKTLGEDDPWLDDTAAWIERSRQLQKEKDLAEKRAKLLEEMDQEFGVSTLVEEE
FGQRRQDLYSARDLQGLTVEHAIDSFREGETMILTLKDKGVLQEEEDVLVNVNLVDKERA
EKNVELRKKKPDYLPYAEDESVDDLAQQKPRSILSKYDEELEGERPHSFRLEQGGTADGL
RERELEEIRAKLRLQAQSLSTVGPRLASEYLTPEEMVTFKKTKRRVKKIRKKEKEVVVRA
DDLLPLGDQTQDGDFGSRLRGRGRRRVSEVEEEKEPVPQPLPSDDTRVENMDISDEEEGG
APPPGSPQVLEEDEAELELQKQLEKGRRLRQLQQLQQLRDSGEKVVEIVKKLESRQRGWE
EDEDPERKGAIVFNATSEFCRTLGEIPTYGLAGNREEQEELMDFERDEERSANGGSESDG
EENIGWSTVNLDEEKQQQDFSASSTTILDEEPIVNRGLAAALLLCQNKGLLETTVQKVAR
VKAPNKSLPSAVYCIEDKMAIDDKYSRREEYRGFTQDFKEKDGYKPDVKIEYVDETGRKL
TPKEAFRQLSHRFHGKGSGKMKTERRMKKLDEEALLKKMSSSDTPLGTVALLQEKQKAQK
TPYIVLSGSGKSMNANTITK
NT seq 2403 nt NT seq  +upstreamnt  +downstreamnt
atggggtcgtccaagaagcatcgcggagagaaggaggcggccgggacgacggcggcggcc
ggcaccgggggtgccaccgagcagccgccgcggcaccgggaacacaaaaaacacaagcac
cggagtggcggcagtggcggtagcggtggcgaacgacggaagcggagccgggaacgtggg
ggcgagcgcgggagcgggcggcgcggggccgaagctgaggcccggagcagcacgcacggg
cgggagcgcagccaggcagagccctccgagcggcgcgtgaagcgggagaagcgcgatgac
ggctacgaggccgctgccagctccaaaactagctcaggcgatgcctcctcactcagcatc
gaggagactaacaaactccgggcaaagttggggctgaaacccttggaggttaatgccatc
aagaaggaggcgggcaccaaggaggagcccgtgacagctgatgtcatcaaccctatggcc
ttgcgacagcgagaggagctgcgggagaagctggcggctgccaaggagaagcgcctgctg
aaccaaaagctggggaagataaagaccctaggagaggatgacccctggctggacgacact
gcagcctggatcgagaggagccggcagctgcagaaggagaaggacctggcagagaagagg
gccaagttactggaggagatggaccaagagtttggtgtcagcactctggtggaggaggag
ttcgggcagaggcggcaggacctgtacagtgcccgggacctgcagggcctcaccgtggag
catgccattgattccttccgagaaggggagacaatgattcttaccctcaaggacaaaggc
gtgctgcaggaggaggaggacgtgctggtgaacgtgaacctggtggataaggagcgggca
gagaaaaatgtggagctgcggaagaagaagcctgactacctgccctatgccgaggacgag
agcgtggacgacctggcgcagcaaaaacctcgctctatcctgtccaagtatgacgaagag
cttgaaggggagcggccacattccttccgcttggagcagggcggcacggctgatggcctg
cgggagcgggagctggaggagatccgggccaagctgcggctgcaggctcagtccctgagc
acagtggggccccggctggcctccgaatacctcacgcctgaggagatggtgacctttaaa
aagaccaagcggagggtgaagaaaatccgcaagaaggagaaggaggtagtagtgcgggca
gatgacttgctgcctctcggggaccagactcaggatggggactttggttccagactgcgg
ggacggggtcgccgccgagtgtccgaagtggaggaggagaaggagcctgtgcctcagccc
ctgccgtcggacgacacccgagtggagaacatggacatcagtgatgaggaggaaggtgga
gctccaccgccggggtccccgcaggtgctggaggaggacgaggcggagctggagctgcag
aagcagctggagaagggacgccggctgcgacagttacagcagctacagcagctgcgagac
agtggcgagaaggtggtggagattgtgaagaagctggagtctcgccagcggggctgggag
gaggatgaggatcccgagcggaagggggccatcgtgttcaacgccacgtccgagttctgc
cgcaccttgggggagatccccacctacgggctggctggcaatcgcgaggagcaggaggag
ctcatggactttgaacgggatgaggagcgctcagccaacggtggctccgaatctgacggg
gaggagaacatcggctggagcacggtgaacctggacgaggagaagcagcagcaggatttc
tctgcttcctccaccaccatcctggacgaggaaccgatcgtgaatagggggctggcagct
gccctgctcctgtgtcagaacaaagggctgctggagaccacagtgcagaaggtggcccgg
gtgaaggcccccaacaagtcgctgccctcagccgtgtactgcatcgaggataagatggcc
atcgatgacaagtacagccggagggaggaataccgaggcttcacacaggacttcaaggag
aaggacggctacaaacccgacgttaagatcgaatacgtggatgagacgggccggaaactc
acacccaaggaggctttccggcagctgtcgcaccgcttccatggcaagggctcaggcaag
atgaagacagagcggcggatgaagaagctggacgaggaggcgctcctgaagaagatgagc
tccagcgacacgcccctgggcaccgtggccctgctccaggagaagcagaaggctcagaag
accccctacatcgtgctcagcggcagcggcaagagcatgaacgcgaacaccatcaccaag
tga

DBGET integrated database retrieval system