KEGG   Homo sapiens (human): 90933
Entry
90933             CDS       T01001                                 
Symbol
TRIM41, RINCK
Name
(RefSeq) tripartite motif containing 41
  KO
K12017  tripartite motif-containing protein 41 [EC:2.3.2.27]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    90933 (TRIM41)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     90933 (TRIM41)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   TRIM/RBCC proteins
    90933 (TRIM41)
SSDB
Motif
Pfam: PRY SPRY zf-C3HC4_4 zf-B_box zf-RING_UBOX zf-C3HC4 zf-C3HC4_2 zf-C3HC4_3 zf-RING_2 Apolipoprotein zf-RING_5 zf-RING_6 Fer2 Phage_lysis DUF1664
Other DBs
NCBI-GeneID: 90933
NCBI-ProteinID: NP_291027
OMIM: 610530
HGNC: 19013
Ensembl: ENSG00000146063
UniProt: Q8WV44
Structure
Position
5:181223281..181235808
AA seq 630 aa
MAAVAMTPNPVQTLQEEAVCAICLDYFTDPVSIGCGHNFCRVCVTQLWGGEDEEDRDELD
REEEEEDGEEEEVEAVGAGAGWDTPMRDEDYEGDMEEEVEEEEEGVFWTSGMSRSSWDNM
DYVWEEEDEEEDLDYYLGDMEEEDLRGEDEEDEEEVLEEVEEEDLDPVTPLPPPPAPRRC
FTCPQCRKSFPRRSFRPNLQLANMVQVIRQMHPTPGRGSRVTDQGICPKHQEALKLFCEV
DEEAICVVCRESRSHKQHSVVPLEEVVQEYKAKLQGHVEPLRKHLEAVQKMKAKEERRVT
ELKSQMKSELAAVASEFGRLTRFLAEEQAGLERRLREMHEAQLGRAGAAASRLAEQAAQL
SRLLAEAQERSQQGGLRLLQDIKETFNRCEEVQLQPPEVWSPDPCQPHSHDFLTDAIVRK
MSRMFCQAARVDLTLDPDTAHPALMLSPDRRGVRLAERRQEVADHPKRFSADCCVLGAQG
FRSGRHYWEVEVGGRRGWAVGAARESTHHKEKVGPGGSSVGSGDASSSRHHHRRRRLHLP
QQPLLQREVWCVGTNGKRYQAQSSTEQTLLSPSEKPRRFGVYLDYEAGRLGFYNAETLAH
VHTFSAAFLGERVFPFFRVLSKGTRIKLCP
NT seq 1893 nt   +upstreamnt  +downstreamnt
atggctgccgttgccatgacacccaaccctgtgcagacccttcaggaggaggcggtgtgc
gccatctgcctcgattacttcacggaccccgtgtccatcggctgcgggcacaacttctgc
cgagtttgtgtaacccagttgtggggtggggaggatgaggaggacagagatgagttagat
cgggaggaggaggaggaggacggagaggaggaggaagtggaggctgtgggggctggcgcg
gggtgggacacccccatgcgggatgaagactacgagggtgacatggaggaggaggtcgag
gaggaagaagagggtgtgttctggaccagtggcatgagcaggtccagctgggacaacatg
gactatgtgtgggaggaggaggacgaggaggaagacctggactactacttgggggacatg
gaggaggaggacctgaggggggaggatgaggaggacgaggaggaagtgctggaggaggtt
gaggaagaggatctagaccccgtcaccccactgcccccgcctccagcccctcggaggtgc
ttcacatgccctcagtgccgaaagagctttcctcggcggagcttccgccccaacctgcag
ctggccaatatggtccaggtgattcggcagatgcacccaacccctggtcgagggagccgc
gtgaccgatcagggcatctgtcccaaacaccaagaagccctgaagctcttctgcgaggta
gacgaagaggccatctgtgtggtgtgccgagaatccaggagccacaaacagcacagcgtg
gtgccattggaggaggtggtgcaggagtacaaggccaaactgcaggggcacgtggaacca
ctgaggaagcacctggaggcagtgcagaagatgaaagccaaggaggagaggcgagtgaca
gaactgaagagccagatgaagtcagagctggcagcggtggcctcggagtttgggcgactg
acacggtttctggctgaagagcaggcagggctggaacggcgtctcagagagatgcatgaa
gcccagctggggcgtgcgggagccgcggctagtcgccttgcagaacaggccgcccagctc
agccgcctgctggcagaggcccaggagcggagccagcaggggggtctccggctgctccag
gacatcaaggagactttcaataggtgtgaagaggtacagctgcagcccccagaggtctgg
tcccctgacccgtgccaaccccatagccatgacttcctgacagatgccatcgtgaggaaa
atgagccggatgttctgtcaggctgcgagagtggacctgacgctggaccctgacacggct
cacccggccctgatgctgtcccctgaccgccggggggtccgcctggcagagcggcggcag
gaggttgctgaccatcccaagcgcttctcggccgactgctgcgtactgggggcccagggc
ttccgctccggccggcactactgggaggtagaggtgggcgggcggcggggctgggcggtg
ggtgctgcccgtgaatcaacccatcataaggaaaaggtgggccctgggggttcctccgtg
ggcagcggggatgccagctcctcgcgccatcaccatcgccgccgccggctccacctgccc
cagcagcccctgctccagcgggaagtgtggtgcgtgggcaccaacggcaaacgctatcag
gcccagagctccacagaacagacgctgctgagccccagtgagaaaccaaggcgctttggt
gtgtacctggactatgaagctgggcgcctgggcttctacaacgcagagactctagcccac
gtgcacaccttctcggctgccttcctgggcgagcgtgtctttcctttcttccgggtgctc
tccaagggcacccgcatcaagctctgcccttga

DBGET integrated database retrieval system