KEGG   Homo sapiens (human): 9095Help
Entry
9095              CDS       T01001                                 

Gene name
TBX19, TBS19, TPIT, dJ747L4.1
Definition
(RefSeq) T-box 19
  KO
K10184  T-box protein 19
Organism
hsa  Homo sapiens (human)
Disease
H01011  Adrenocorticotropic hormone deficiency
H01700  Hypopituitarism
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    9095 (TBX19)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Other transcription factors
   T-box
    9095 (TBX19)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: T-box
Motif
Other DBs
NCBI-GeneID: 9095
NCBI-ProteinID: NP_005140
OMIM: 604614
HGNC: 11596
Ensembl: ENSG00000143178
Vega: OTTHUMG00000034648
Pharos: O60806(Tbio)
UniProt: O60806 B3KRD9
Position
1q24.2
AA seq 448 aa AA seqDB search
MAMSELGTRKPSDGTVSHLLNVVESELQAGREKGDPTEKQLQIILEDAPLWQRFKEVTNE
MIVTKNGRRMFPVLKISVTGLDPNAMYSLLLDFVPTDSHRWKYVNGEWVPAGKPEVSSHS
CVYIHPDSPNFGAHWMKAPISFSKVKLTNKLNGGGQIMLNSLHKYEPQVHIVRVGSAHRM
VTNCSFPETQFIAVTAYQNEEITALKIKYNPFAKAFLDAKERNHLRDVPEAISESQHVTY
SHLGGWIFSNPDGVCTAGNSNYQYAAPLPLPAPHTHHGCEHYSGLRGHRQAPYPSAYMHR
NHSPSVNLIESSSNNLQVFSGPDSWTSLSSTPHASILSVPHTNGPINPGPSPYPCLWTIS
NGAGGPSGPGPEVHASTPGAFLLGNPAVTSPPSVLSTQAPTSAGVEVLGEPSLTSIAVST
WTAVASHPFAGWGGPGAGGHHSPSSLDG
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
atggccatgagtgagctgggcactcggaagcccagcgatggcactgtttctcatctgctc
aatgtggtggagagtgagcttcaggcagggagggaaaaaggcgaccctacggagaagcaa
cttcagatcatcctggaggatgcacctctctggcagagattcaaggaagtcactaatgag
atgattgtgaccaagaatggcagacggatgtttccagtcctaaagattagtgtcacaggg
ttggaccccaatgccatgtactccctcctgctggactttgtccctacggacagtcaccgc
tggaagtacgtcaacggggaatgggtgcccgctggcaagccagaggtctccagccacagc
tgcgtctacattcacccggactcccccaactttggggcccactggatgaaagctcccatc
tccttcagcaaagtgaagctgaccaacaagctcaatggaggcgggcagataatgttgaat
tctctgcataaatatgaaccccaggttcacatagtgcgtgttggaagtgcccatcgaatg
gtaacaaactgctccttccctgaaacccagttcatagccgtgactgcctatcagaatgag
gagataacggctctcaaaatcaagtacaatccttttgccaaagccttcttggatgccaag
gaaagaaatcacctaagagacgtaccggaggctatctctgagagccagcatgtgacctat
tctcacttgggaggctggatcttttccaatccagatggagtgtgcacagcaggaaactcc
aattaccagtatgccgctcctctgcctctgcctgctccccacacccaccatggctgtgag
cactattcgggtctccgaggacaccggcaggctccctacccttctgcgtacatgcacaga
aaccattctccctcagtgaatttgatagaaagctcaagcaataatctgcaagttttctcg
ggacctgacagctggacttccttatcctccacaccccatgccagcatcctgtctgtaccc
cacaccaacggaccaatcaatccagggcccagcccctacccgtgcctgtggaccatcagc
aatggtgccggaggccccagtgggccaggcccggaggtgcacgccagcaccccaggagca
tttctcctcggaaacccagctgtgacttcacccccttctgtgctctccacccaagcaccc
acttcggctggtgtggaggttctgggggagccctcgctaaccagcattgctgtgtccacc
tggacagcagtggcctcgcatcccttcgcgggctggggtggcccaggagcgggtgggcac
cattctccttcctcactggatggttaa

DBGET integrated database retrieval system