KEGG   Homo sapiens (human): 9096
Entry
9096              CDS       T01001                                 

Gene name
TBX18, CAKUT2
Definition
(RefSeq) T-box transcription factor 18
  KO
K10183  T-box protein 18
Organism
hsa  Homo sapiens (human)
Disease
H01867  Congenital anomalies of kidney and urinary tract
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    9096 (TBX18)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Other transcription factors
   T-box
    9096 (TBX18)
SSDB
Motif
Pfam: T-box
Other DBs
NCBI-GeneID: 9096
NCBI-ProteinID: NP_001073977
OMIM: 604613
HGNC: 11595
Ensembl: ENSG00000112837
Vega: OTTHUMG00000015129
Pharos: O95935(Tbio)
UniProt: O95935
Position
6q14.3
AA seq 607 aa
MAEKRRGSPCSMLSLKAHAFSVEALIGAEKQQQLQKKRRKLGAEEAAGAVDDGGCSRGGG
AGEKGSSEGDEGAALPPPAGATSGPARSGADLERGAAGGCEDGFQQGASPLASPGGSPKG
SPARSLARPGTPLPSPQAPRVDLQGAELWKRFHEIGTEMIITKAGRRMFPAMRVKISGLD
PHQQYYIAMDIVPVDNKRYRYVYHSSKWMVAGNADSPVPPRVYIHPDSPASGETWMRQVI
SFDKLKLTNNELDDQGHIILHSMHKYQPRVHVIRKDCGDDLSPIKPVPSGEGVKAFSFPE
TVFTTVTAYQNQQITRLKIDRNPFAKGFRDSGRNRMGLEALVESYAFWRPSLRTLTFEDI
PGIPKQGNASSSTLLQGTGNGVPATHPHLLSGSSCSSPAFHLGPNTSQLCSLAPADYSAC
ARSGLTLNRYSTSLAETYNRLTNQAGETFAPPRTPSYVGVSSSTSVNMSMGGTDGDTFSC
PQTSLSMQISGMSPQLQYIMPSPSSNAFATNQTHQGSYNTFRLHSPCALYGYNFSTSPKL
AASPEKIVSSQGSFLGSSPSGTMTDRQMLPPVEGVHLLSSGGQQSFFDSRTLGSLTLSSS
QVSAHMV
NT seq 1824 nt   +upstreamnt  +downstreamnt
atggccgagaagcgaaggggctcgccgtgcagcatgctaagcctcaaggcgcacgctttc
tcggtggaggcgctgatcggcgccgagaagcagcaacagcttcagaagaagcggcgaaaa
ctgggcgccgaagaggcggcgggggccgtggacgacggaggctgcagccgcggcggcggc
gcgggcgaaaagggttcttctgagggagacgaaggcgctgcgctcccgccgccggctggg
gcgacgtctgggccggctcggagtggcgcagacctggagcgcggagccgcgggcggctgt
gaggacggcttccagcagggagcttcccctctggcgtcaccgggaggctcccccaagggg
tctccggcgcgctccctggcccggcccgggacccctctgccctcgccgcaggccccgcgg
gtggatctgcagggagccgagctctggaagcgctttcatgagataggcactgagatgatc
atcaccaaggccggcaggcgcatgtttccagcaatgagagtgaagatctctggattagat
cctcaccagcaatattacattgccatggatattgtaccagtggacaacaaaagatacagg
tatgtttaccacagttcgaaatggatggtggcaggtaatgctgactcgcctgtgccaccc
cgtgtgtacattcatccagactcgcctgcctcgggggagacttggatgagacaagttatc
agcttcgacaagctgaagctcaccaacaatgaactggatgaccaaggccatattattctt
cattctatgcacaaataccaaccgcgagtgcacgtcatccgtaaagactgtggagacgat
ctttctcccatcaagcctgttccatccggggagggagtaaaggcattctcctttccagaa
actgtcttcacaaccgtcactgcctatcagaatcagcagattactcgcctgaagatagat
aggaatccatttgctaaaggcttccgagactccgggcgcaacagaatgggtttggaagcc
ttggtggaatcatatgcattctggcgaccatcactacggactctgacctttgaagatatc
cctggaattcccaagcaaggcaatgcaagttcctccaccttgctccaaggtactgggaat
ggcgttcctgccactcaccctcaccttttgtctggctcctcttgctcctctcctgccttc
catctggggcccaacaccagccagctgtgtagtctggcccctgctgactattctgcctgt
gcccgctcaggcctcaccctcaaccgatacagcacatctttggcagagacctacaacagg
ctcaccaaccaggctggtgagacctttgccccgcccaggactccctcctatgtgggcgtg
agcagcagcacctccgtgaacatgtccatgggtggcactgatggggacaccttcagctgc
ccacagaccagcttatccatgcagatttcgggaatgtccccccagctccagtatatcatg
ccatcaccctccagcaatgccttcgccactaaccagacccatcagggttcctataatact
tttagattacacagcccctgtgcactatatggatataacttctccacatcccccaaactg
gctgccagtcctgagaaaattgtttcttcccaaggaagtttcttggggtcctcaccgagt
gggaccatgacggatcggcagatgttgccccctgtggaaggagtgcacctgcttagcagt
gggggtcagcagagtttctttgactctaggaccctaggaagcttaactctgtcatcatct
caagtatctgcacatatggtctga

DBGET integrated database retrieval system