KEGG   Homo sapiens (human): 9097
Entry
9097              CDS       T01001                                 

Gene name
USP14, TGT
Definition
(RefSeq) ubiquitin specific peptidase 14
  KO
K11843  ubiquitin carboxyl-terminal hydrolase 14 [EC:3.4.19.12]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    9097 (USP14)
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    9097 (USP14)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     9097 (USP14)
Peptidases and inhibitors [BR:hsa01002]
 Cysteine peptidases
  Family C19: ubiquitin-specific protease family
   9097 (USP14)
Ubiquitin system [BR:hsa04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    9097 (USP14)
SSDB
Motif
Pfam: UCH UCH_1 ubiquitin Peptidase_C98
Other DBs
NCBI-GeneID: 9097
NCBI-ProteinID: NP_005142
OMIM: 607274
HGNC: 12612
Ensembl: ENSG00000101557
Vega: OTTHUMG00000178040
Pharos: P54578(Tbio)
UniProt: P54578
Structure
PDB: 

Position
18p11.32
AA seq 494 aa
MPLYSVTVKWGKEKFEGVELNTDEPPMVFKAQLFALTGVQPARQKVMVKGGTLKDDDWGN
IKIKNGMTLLMMGSADALPEEPSAKTVFVEDMTEEQLASAMELPCGLTNLGNTCYMNATV
QCIRSVPELKDALKRYAGALRASGEMASAQYITAALRDLFDSMDKTSSSIPPIILLQFLH
MAFPQFAEKGEQGQYLQQDANECWIQMMRVLQQKLEAIEDDSVKETDSSSASAATPSKKK
SLIDQFFGVEFETTMKCTESEEEEVTKGKENQLQLSCFINQEVKYLFTGLKLRLQEEITK
QSPTLQRNALYIKSSKISRLPAYLTIQMVRFFYKEKESVNAKVLKDVKFPLMLDMYELCT
PELQEKMVSFRSKFKDLEDKKVNQQPNTSDKKSSPQKEVKYEPFSFADDIGSNNCGYYDL
QAVLTHQGRSSSSGHYVSWVKRKQDEWIKFDDDKVSIVTPEDILRLSGGGDWHIAYVLLY
GPRRVEIMEEESEQ
NT seq 1485 nt   +upstreamnt  +downstreamnt
atgccgctctactccgttactgtaaaatggggaaaggagaaatttgaaggtgtagaattg
aatacagatgaacctccaatggtattcaaggctcagctgtttgcgttgactggagtccag
cctgccagacagaaagttatggtgaaaggaggaacgctaaaggatgatgattggggaaac
atcaaaataaaaaatggaatgactctactaatgatggggtcagcagatgctcttccagaa
gaaccctcagccaaaactgtcttcgtagaagacatgacagaagaacagttagcatctgct
atggagttaccatgtggattgacaaaccttggtaacacttgttacatgaatgccacagtt
cagtgtattcgttctgtgcctgaactcaaagatgcccttaaaaggtatgcaggtgccttg
agagcttcaggggaaatggcttcagcgcagtatattactgcagcccttagagatttgttt
gattccatggataaaacttcttccagtattccacctattattctactgcagtttttgcac
atggctttcccacagtttgccgagaaaggtgaacaaggacagtatcttcaacaggatgct
aatgaatgttggatacaaatgatgcgagtattgcaacagaaattggaagcaatagaggat
gattctgttaaagagacagactcctcatctgcatcggcagcgacaccttctaaaaagaaa
agtttaatcgatcagttcttcggtgttgagtttgaaactaccatgaaatgtacagaatct
gaagaagaagaagtcaccaaaggaaaggaaaatcaacttcagcttagctgttttatcaat
caggaagtcaagtatctttttacaggacttaaattgcgacttcaggaagaaatcaccaaa
cagtctccaacgttgcaaagaaatgccttgtatatcaaatcttccaagatcagccggctg
cctgcttacttgaccattcagatggttcgatttttttataaagagaaggaatctgtgaat
gccaaagttcttaaggatgttaaatttcctcttatgttggatatgtatgaactgtgtaca
ccagaacttcaagagaaaatggtgtcttttcgatccaaattcaaggatctagaagataaa
aaagtgaatcagcagccaaatacaagtgacaaaaagagtagtccccagaaagaagttaag
tatgaacccttttcttttgctgatgatattggctccaataattgtggatactatgactta
caagcagtactaacacaccagggaaggtctagttcttcaggtcattatgtatcatgggtg
aaaaggaaacaagatgaatggattaagtttgatgatgacaaagtcagcatcgtaacacca
gaagatatcttacggctttctggtggtggagactggcatatcgcttacgttctactctat
gggcctcgcagagttgaaataatggaagaggaaagtgaacagtaa

DBGET integrated database retrieval system