KEGG   Homo sapiens (human): 9099
Entry
9099              CDS       T01001                                 

Gene name
USP2, UBP41, USP9
Definition
(RefSeq) ubiquitin specific peptidase 2
  KO
K11833  ubiquitin carboxyl-terminal hydrolase 2 [EC:3.4.19.12]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    9099 (USP2)
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    9099 (USP2)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     9099 (USP2)
Peptidases and inhibitors [BR:hsa01002]
 Cysteine peptidases
  Family C19: ubiquitin-specific protease family
   9099 (USP2)
Ubiquitin system [BR:hsa04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    9099 (USP2)
SSDB
Motif
Pfam: UCH UCH_1
Other DBs
NCBI-GeneID: 9099
NCBI-ProteinID: NP_004196
OMIM: 604725
HGNC: 12618
Ensembl: ENSG00000036672
Vega: OTTHUMG00000166200
Pharos: O75604(Tbio)
UniProt: O75604
Structure
PDB: 

Position
11q23.3
AA seq 605 aa
MSQLSSTLKRYTESARYTDAHYAKSGYGAYTPSSYGANLAASLLEKEKLGFKPVPTSSFL
TRPRTYGPSSLLDYDRGRPLLRPDITGGGKRAESQTRGTERPLGSGLSGGSGFPYGVTNN
CLSYLPINAYDQGVTLTQKLDSQSDLARDFSSLRTSDSYRIDPRNLGRSPMLARTRKELC
TLQGLYQTASCPEYLVDYLENYGRKGSASQVPSQAPPSRVPEIISPTYRPIGRYTLWETG
KGQAPGPSRSSSPGRDGMNSKSAQGLAGLRNLGNTCFMNSILQCLSNTRELRDYCLQRLY
MRDLHHGSNAHTALVEEFAKLIQTIWTSSPNDVVSPSEFKTQIQRYAPRFVGYNQQDAQE
FLRFLLDGLHNEVNRVTLRPKSNPENLDHLPDDEKGRQMWRKYLEREDSRIGDLFVGQLK
SSLTCTDCGYCSTVFDPFWDLSLPIAKRGYPEVTLMDCMRLFTKEDVLDGDEKPTCCRCR
GRKRCIKKFSIQRFPKILVLHLKRFSESRIRTSKLTTFVNFPLRDLDLREFASENTNHAV
YNLYAVSNHSGTTMGGHYTAYCRSPGTGEWHTFNDSSVTPMSSSQVRTSDAYLLFYELAS
PPSRM
NT seq 1818 nt   +upstreamnt  +downstreamnt
atgtcccagctctcctccaccctgaagcgctacacagaatcggcccgctacacagatgcc
cactatgccaagtcgggctatggtgcctacaccccgtcctcctatggggccaatctggct
gcctccttactggagaaggagaaacttggtttcaagccggtccccaccagcagcttcctc
acccgtccccgtacctatggcccctcctccctcctggactatgaccggggccgccccctg
ctgagacccgacatcactgggggtggtaagcgggcagagagccagacccggggtactgag
cggcctttaggcagtggcctcagcgggggcagcggattcccttatggagtgaccaacaac
tgcctcagctacctgcccatcaatgcctatgaccagggggtgaccctaacccagaagctg
gacagccaatcagacctggcccgggatttctccagcctccggacctcagatagctaccgg
atagaccccaggaacctgggccgcagccccatgctggcccggacgcgcaaggagctctgc
accctgcaggggctctaccagacagccagctgccctgaatacctggtcgactacctggag
aactatggtcgcaagggcagtgcatctcaggtgccctcccaggcccctccctcacgagtc
cctgaaatcatcagcccaacctaccgacccattggccgctacacgctgtgggagacggga
aagggtcaggcccctgggcccagccgctccagctccccgggaagagacggcatgaattct
aagagtgcccagggtctggctggtcttcgaaaccttgggaacacgtgcttcatgaactca
attctgcagtgcctgagcaacactcgggagttgagagattactgcctccagaggctctac
atgcgggacctgcaccacggcagcaatgcacacacagccctcgtggaagagtttgcaaaa
ctaattcagaccatatggacttcatcccccaatgatgtggtgagcccatctgagttcaag
acccagatccagagatacgcaccgcgctttgttggctataatcagcaggatgctcaggag
ttccttcgctttcttctggatgggctccataacgaggtgaaccgagtgacactgagacct
aagtccaaccctgagaacctcgatcatcttcctgatgacgagaaaggccgacagatgtgg
agaaaatatctagaacgggaagacagtaggatcggggatctctttgttgggcagctaaag
agctcgctgacgtgtacagattgtggttactgttctacggtcttcgaccccttctgggac
ctctcactgcccattgctaagcgaggttatcctgaggtgacattaatggactgcatgagg
ctcttcaccaaagaggatgtgcttgatggagatgaaaagccaacatgctgtcgctgccga
ggcagaaaacggtgtataaagaagttctccatccagaggttcccaaagatcttggtgctc
catctgaagcggttctcagaatccaggatccgaaccagcaagctcacaacatttgtgaac
ttccccctaagagacctggacttaagagaatttgcctcagaaaacaccaaccatgctgtt
tacaacctgtacgctgtgtccaatcactccggaaccaccatgggtggccactatacagcc
tactgtcgcagtccagggacaggagaatggcacactttcaacgactccagcgtcactccc
atgtcctccagccaagtgcgcaccagcgacgcctacctgctcttctacgaactggccagc
ccgccctcccgaatgtag

DBGET integrated database retrieval system