KEGG   Homo sapiens (human): 91
Entry
91                CDS       T01001                                 
Symbol
ACVR1B, ACTRIB, ACVRLK4, ALK4, SKR2
Name
(RefSeq) activin A receptor type 1B
  KO
K13567  activin receptor type-1B [EC:2.7.11.30]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04350  TGF-beta signaling pathway
hsa04550  Signaling pathways regulating pluripotency of stem cells
Network
nt06507  TGFB signaling
  Element
N01456  Activin signaling pathway
N01457  Myostatin signaling pathway
N01459  Nodal signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    91 (ACVR1B)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    91 (ACVR1B)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    91 (ACVR1B)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    91 (ACVR1B)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     91 (ACVR1B)
Protein kinases [BR:hsa01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR1 family [OT]
   91 (ACVR1B)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr TGF_beta_GS Activin_recp APH Pkinase_fungal FTA2
Other DBs
NCBI-GeneID: 91
NCBI-ProteinID: NP_004293
OMIM: 601300
HGNC: 172
Ensembl: ENSG00000135503
Pharos: P36896(Tchem)
UniProt: P36896
Structure
Position
12:51951699..51997078
AA seq 505 aa
MAESAGASSFFPLVVLLLAGSGGSGPRGVQALLCACTSCLQANYTCETDGACMVSIFNLD
GMEHHVRTCIPKVELVPAGKPFYCLSSEDLRNTHCCYTDYCNRIDLRVPSGHLKEPEHPS
MWGPVELVGIIAGPVFLLFLIIIIVFLVINYHQRVYHNRQRLDMEDPSCEMCLSKDKTLQ
DLVYDLSTSGSGSGLPLFVQRTVARTIVLQEIIGKGRFGEVWRGRWRGGDVAVKIFSSRE
ERSWFREAEIYQTVMLRHENILGFIAADNKDNGTWTQLWLVSDYHEHGSLFDYLNRYTVT
IEGMIKLALSAASGLAHLHMEIVGTQGKPGIAHRDLKSKNILVKKNGMCAIADLGLAVRH
DAVTDTIDIAPNQRVGTKRYMAPEVLDETINMKHFDSFKCADIYALGLVYWEIARRCNSG
GVHEEYQLPYYDLVPSDPSIEEMRKVVCDQKLRPNIPNWWQSYEALRVMGKMMRECWYAN
GAARLTALRIKKTLSQLSVQEDVKI
NT seq 1518 nt   +upstreamnt  +downstreamnt
atggcggagtcggccggagcctcctccttcttcccccttgttgtcctcctgctcgccggc
agcggcgggtccgggccccggggggtccaggctctgctgtgtgcgtgcaccagctgcctc
caggccaactacacgtgtgagacagatggggcctgcatggtttccattttcaatctggat
gggatggagcaccatgtgcgcacctgcatccccaaagtggagctggtccctgccgggaag
cccttctactgcctgagctcggaggacctgcgcaacacccactgctgctacactgactac
tgcaacaggatcgacttgagggtgcccagtggtcacctcaaggagcctgagcacccgtcc
atgtggggcccggtggagctggtaggcatcatcgccggcccggtgttcctcctgttcctc
atcatcatcattgttttccttgtcattaactatcatcagcgtgtctatcacaaccgccag
agactggacatggaagatccctcatgtgagatgtgtctctccaaagacaagacgctccag
gatcttgtctacgatctctccacctcagggtctggctcagggttacccctctttgtccag
cgcacagtggcccgaaccatcgttttacaagagattattggcaagggtcggtttggggaa
gtatggcggggccgctggaggggtggtgatgtggctgtgaaaatattctcttctcgtgaa
gaacggtcttggttcagggaagcagagatataccagacggtcatgctgcgccatgaaaac
atccttggatttattgctgctgacaataaagataatggcacctggacacagctgtggctt
gtttctgactatcatgagcacgggtccctgtttgattatctgaaccggtacacagtgaca
attgaggggatgattaagctggccttgtctgctgctagtgggctggcacacctgcacatg
gagatcgtgggcacccaagggaagcctggaattgctcatcgagacttaaagtcaaagaac
attctggtgaagaaaaatggcatgtgtgccatagcagacctgggcctggctgtccgtcat
gatgcagtcactgacaccattgacattgccccgaatcagagggtggggaccaaacgatac
atggcccctgaagtacttgatgaaaccattaatatgaaacactttgactcctttaaatgt
gctgatatttatgccctcgggcttgtatattgggagattgctcgaagatgcaattctgga
ggagtccatgaagaatatcagctgccatattacgacttagtgccctctgacccttccatt
gaggaaatgcgaaaggttgtatgtgatcagaagctgcgtcccaacatccccaactggtgg
cagagttatgaggcactgcgggtgatggggaagatgatgcgagagtgttggtatgccaac
ggcgcagcccgcctgacggccctgcgcatcaagaagaccctctcccagctcagcgtgcag
gaagacgtgaagatctaa

DBGET integrated database retrieval system