KEGG   Homo sapiens (human): 91010Help
Entry
91010             CDS       T01001                                 

Gene name
FMNL3, FHOD3, FRL2, WBP-3, WBP3
Definition
(RefSeq) formin like 3
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: FH2 Drf_FH3 Drf_GBD COG2
Motif
Other DBs
NCBI-GeneID: 91010
NCBI-ProteinID: NP_783863
OMIM: 616288
HGNC: 23698
Ensembl: ENSG00000161791
Vega: OTTHUMG00000169651
Pharos: Q8IVF7(Tbio)
UniProt: Q8IVF7
Position
12q13.12
AA seq 1027 aa AA seqDB search
MGNLESAEGVPGEPPSVPLLLPPGKMPMPEPCELEERFALVLSSMNLPPDKARLLRQYDN
EKKWDLICDQERFQVKNPPHTYIQKLQSFLDPSVTRKKFRRRVQESTKVLRELEISLRTN
HIGWVREFLNDENKGLDVLVDYLSFAQCSVMFDFEGLESGDDGAFDKLRSWSRSIEDLQP
PSALSAPFTNSLARSARQSVLRYSTLPGRRALKNSRLVSQKDDVHVCILCLRAIMNYQYG
FNLVMSHPHAVNEIALSLNNKNPRTKALVLELLAAVCLVRGGHEIILAAFDNFKEVCKEL
HRFEKLMEYFRNEDSNIDFMVACMQFINIVVHSVEDMNFRVHLQYEFTKLGLEEFLQKSR
HTESEKLQVQIQAYLDNVFDVGGLLEDAETKNVALEKVEELEEHVSHLTEKLLDLENENM
MRVAELEKQLLQREKELESIKETYENTSHQVHTLRRLIKEKEEAFQRRCHLEPNVRGLES
VDSEALARVGPAELSEGMPPSDLDLLAPAPPPEEVLPLPPPPAPPLPPPPPPLPDKCPPA
PPLPGAAPSVVLTVGLSAIRIKKPIKTKFRLPVFNWTALKPNQISGTVFSELDDEKILED
LDLDKFEELFKTKAQGPALDLICSKNKTAQKAASKVTLLEANRAKNLAITLRKAGRSAEE
ICRAIHTFDLQTLPVDFVECLMRFLPTEAEVKLLRQYERERQPLEELAAEDRFMLLFSKV
ERLTQRMAGMAFLGNFQDNLQMLTPQLNAIIAASASVKSSQKLKQMLEIILALGNYMNSS
KRGAVYGFKLQSLDLLLDTKSTDRKMTLLHFIALTVKEKYPDLANFWHELHFVEKAAAVS
LENVLLDVKELGRGMELIRRECSIHDNSVLRNFLSTNEGKLDKLQRDAKTAEEAYNAVVR
YFGESPKTTPPSVFFPVFVRFIRSYKEAEQENEARKKQEEVMREKQLAQEAKKLDAKTPS
QRNKWQQQELIAELRRRQAKEHRPVYEGKDGTIEDIITGLHCQPMVVRHQARSAAPPSGP
PRAPGPH
NT seq 3084 nt NT seq  +upstreamnt  +downstreamnt
atgggcaacctggagagcgccgagggggtcccgggagagcccccctctgtcccgttgttg
ctgccgcccggcaagatgccgatgcctgagccctgtgagctggaggaaaggttcgccctg
gtgctgagctccatgaacctgcctccagacaaggcccggctcctgcggcagtatgacaat
gagaagaaatgggatctgatctgtgaccaggaacgattccaggtgaagaatcctccccac
acttacattcagaaactccagagcttcttggaccccagtgtaactcggaagaagttcagg
aggagggtgcaggagtcaaccaaagtactaagggagctggagatctctcttcgcaccaac
cacattgggtgggtgcgggaatttctgaatgatgaaaacaaaggcctggatgtactggtg
gattacctgtcctttgcccagtgttctgtcatgtttgactttgagggtctggaaagtggt
gacgatggtgcatttgacaaactccggtcctggagcaggtcaatcgaggacctgcagcca
cccagcgccctgtcggcccccttcaccaacagcctcgctcgctctgcgcgccagtctgtg
ctccggtatagcactctccctgggcgcagggccctgaagaactcccgcctagtgagccag
aaggatgacgtccacgtctgtatcctttgtctcagagccatcatgaactatcagtacgga
ttcaacctggtcatgtcccacccccatgctgtcaatgagattgcacttagcctcaataac
aagaatccaaggaccaaagcccttgtcttagagcttctggcagctgtgtgtttggtgcga
ggaggtcacgaaatcatccttgctgcctttgacaatttcaaagaggtatgcaaggagctg
caccgctttgagaagctgatggagtatttccggaatgaggacagcaatattgacttcatg
gtggcctgcatgcagttcatcaacatcgtggtgcactcggtggaggacatgaacttccgg
gtccacctgcagtatgagtttaccaagctggggctagaggagttcctgcagaagtcaagg
cacacagagagcgagaagctgcaggtgcagattcaggcatatctggacaacgtgtttgat
gtcgggggtttgttggaggatgctgagaccaagaatgtagccctggagaaggtggaggag
ttggaggagcatgtgtcccatctcacagagaagcttctggacctagagaatgaaaacatg
atgcgggtggcagaactagagaagcagctgctacagcgggagaaggaactagagagcatc
aaggagacatatgagaacacaagccaccaggtgcacaccctgcggaggctcattaaagag
aaggaggaggcctttcagcgtcgatgtcatttggagccaaatgtccggggcctggagtct
gtggacagtgaggccctggccagagtaggccctgcagagctgagtgagggcatgccaccc
tccgacctggaccttctggctccagccccaccccctgaggaggtcctgcctcttcctcca
ccaccagctccgcccttgccccctccacctcccccattaccagacaagtgtcccccagcc
ccacctctccctggtgctgcaccctctgtggtgttgacagtgggcctgtcagccattcga
attaagaaacctatcaagaccaagttccggctgcctgtcttcaactggacagcactgaaa
cccaaccagatcagtggcactgtcttcagcgaacttgatgatgagaagatcttggaggac
ctggatcttgataagtttgaagaattattcaagacaaaagcgcagggccctgcccttgac
ctcatctgctccaaaaacaagacagcgcaaaaagctgccagcaaggtgactctgttggaa
gccaatcgtgccaagaacctggccatcaccctacgcaaggctggccgctcggctgaggag
atctgcagggccattcatacgtttgacttgcagacactacctgtggacttcgtggagtgc
ctgatgcgcttcctgcccacagaggctgaggtaaagctgctgcggcaatatgagcgggag
cggcagcccctggaggagttggcagctgaggaccgcttcatgctgctcttcagcaaggtg
gaacggttgacccagcgaatggctggcatggccttcctggggaacttccaggataacctg
cagatgctcacaccgcaactcaatgccatcattgcggcgtccgcttccgtcaagtcttca
cagaagctgaagcagatgttggagatcatacttgcactggggaactacatgaacagcagc
aagcggggagctgtgtatggcttcaagctccagagcctggatctgctgctggataccaag
tccactgaccggaagatgacactgcttcatttcatcgccttgacagtgaaggagaaatac
ccagacctggctaacttctggcatgagctgcactttgttgagaaggctgcagcagtgtcc
ctggagaacgtgctgctggacgtgaaggagctgggccggggcatggagctgattcggcgt
gagtgcagcatccatgacaacagcgtcctccggaacttcctcagtaccaatgaaggcaaa
ctagacaagctccagcgggacgccaagacggctgaggaggcctacaatgcagttgtgcgc
tactttggcgagagtcccaagactacacctccttctgtattcttcccagtatttgtccga
ttcattcgttcttacaaggaagcagaacaagagaatgaagcccgcaagaagcaggaggag
gtaatgcgggagaagcagctggctcaggaagccaagaaactggatgccaagaccccatcc
cagcggaacaagtggcaacagcaggagttaatagcagagttgaggcggcgccaggccaag
gaacaccggcctgtttatgaggggaaggatggtaccatcgaggacatcatcacaggcctc
cactgccagcctatggttgttcgccaccaagccaggagtgctgcaccgcccagtggtccc
cctcgggctccaggcccccactga

DBGET integrated database retrieval system