KEGG   Homo sapiens (human): 91012Help
Entry
91012             CDS       T01001                                 

Gene name
CERS5, LASS5, Trh4
Definition
(RefSeq) ceramide synthase 5
  KO
K23727  sphingoid base N-palmitoyltransferase [EC:2.3.1.291]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00600  Sphingolipid metabolism
hsa01100  Metabolic pathways
hsa04071  Sphingolipid signaling pathway
Module
hsa_M00094  Ceramide biosynthesis
hsa_M00099  Sphingosine biosynthesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    91012 (CERS5)
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    91012 (CERS5)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.291  sphingoid base N-palmitoyltransferase
     91012 (CERS5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TRAM_LAG1_CLN8 Homeodomain
Motif
Other DBs
NCBI-GeneID: 91012
NCBI-ProteinID: NP_671723
OMIM: 615335
HGNC: 23749
Ensembl: ENSG00000139624
Vega: OTTHUMG00000169819
Pharos: Q8N5B7(Tbio)
UniProt: Q8N5B7
Position
12q13.12
AA seq 392 aa AA seqDB search
MATAAQGPLSLLWGWLWSERFWLPENVSWADLEGPADGYGYPRGRHILSVFPLAAGIFFV
RLLFERFIAKPCALCIGIEDSGPYQAQPNAILEKVFISITKYPDKKRLEGLSKQLDWNVR
KIQCWFRHRRNQDKPPTLTKFCESMWRFTFYLCIFCYGIRFLWSSPWFWDIRQCWHNYPF
QPLSSGLYHYYIMELAFYWSLMFSQFTDIKRKDFLIMFVHHLVTIGLISFSYINNMVRVG
TLIMCLHDVSDFLLEAAKLANYAKYQRLCDTLFVIFSAVFMVTRLGIYPFWILNTTLFES
WEIIGPYASWWLLNGLLLTLQLLHVIWSYLIARIALKALIRGKVSKDDRSDVESSSEEED
VTTCTKSPCDSSSSNGANRVNGHMGGSYWAEE
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atggcgacagcagcgcagggacccctaagcttgctgtggggctggctgtggagcgagcgc
ttctggctacccgagaacgtgagctgggctgatctggaggggccggccgacggctacggt
tacccccgcggccggcacatcctctcggtgttcccgctggcggcgggcatcttcttcgtg
aggctgctcttcgagcgatttattgccaaaccctgtgcactctgtattggcatcgaggac
agtggtccttatcaggcccaacccaatgccatccttgaaaaggtgttcatatctattacc
aagtatcctgataagaaaaggctggagggcctgtcaaagcagctggattggaatgtccga
aaaatccaatgctggtttcgccatcggaggaatcaggacaagcccccaacgcttactaaa
ttctgtgaaagcatgtggagattcacattttatttatgtatattctgctatggaattaga
tttctctggtcgtcaccttggttctgggacatccgacagtgctggcataactatccattt
cagcctctttcaagtgggctttatcactattatatcatggaattggccttctattggtcc
cttatgttttctcagtttacagacattaaaagaaaggacttcctgatcatgtttgtgcat
cacttggtcaccattgggcttatctccttctcctacatcaacaatatggttcgagtggga
actctgatcatgtgtctacatgatgtctcagacttcttgctggaggcagccaaactggcc
aattatgccaagtatcagcggctctgtgacaccctttttgtgatcttcagtgctgttttt
atggttacacgactaggaatctatccattctggattctgaacacgaccctctttgagagt
tgggagataatcgggccttatgcttcatggtggctcctcaatggcctgctgctgacccta
cagcttctgcatgtcatctggtcctacctaattgcacggattgctttgaaagccttgatc
aggggaaaggtatcgaaggatgatcgcagtgatgtggagagcagctcagaggaagaagat
gtgaccacctgcacaaaaagtccctgtgacagtagctccagcaatggtgccaatcgggtg
aatggtcacatgggaggcagctactgggctgaagagtaa

DBGET integrated database retrieval system