KEGG   Homo sapiens (human): 91050
Entry
91050             CDS       T01001                                 
Symbol
CCDC149
Name
(RefSeq) coiled-coil domain containing 149
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: CC149 CorA DUF6026 Csm1_N THP2 TSC22 EzrA Fin Laminin_II HAP1_N Crescentin Herpes_UL6 CCDC144C
Other DBs
NCBI-GeneID: 91050
NCBI-ProteinID: NP_001317573
HGNC: 25405
Ensembl: ENSG00000181982
Pharos: Q6ZUS6(Tdark)
UniProt: Q6ZUS6
Position
4:complement(24803514..24980204)
AA seq 474 aa
MANQLRERHQSLKKKYRELIDGDPSLPPEKRKQANLAQLLRDSQDRNKHLGEEIKELQQR
LGEVQGDNKLLRMTIAKQRLGDEAIGVRHFAAHEREDLVQQLERAKEQIESLEHDLQASV
DELQDVKEERSSYQDKVERLNQELNHILSGHENRIIDVDALCMENRYLQERLKQLHEEVN
LLKSNIAKYKNALERRKNSKGQGKSSSSALTGVLSAKQVQDLLSEDHGCSLPATPQSISD
LKSLATALLETIHEKNMVIQHQRQTNKILGNRVAELEKKLRTLEVSGLWSLPGGKDTILF
SDPTLPSGQRSRSPLLKFVEQPTENKADPKDGEAQKQEEDESCAAAEALTAPEDAGRPAV
NSPANQSRGNQCKLFHPSLPQLPSEEEVNSLGREIIKLTKEQAAAELEEVRRESPIEGQR
SETGPAPPGLAIQGELPKSHLDSFEASRPAAKASTPEDGKGIPEGGGMRSTVKT
NT seq 1425 nt   +upstreamnt  +downstreamnt
atggccaatcagctccgggagcgccaccagtcactgaagaagaagtaccgagagctgatt
gatggagatccatcacttcctcctgaaaaaaggaaacaggctaatcttgcacaactattg
agagattctcaggaccgaaataaacatctgggagaagaaattaaagaacttcagcaaagg
cttggagaagtccagggcgacaacaagctcttgaggatgacgattgccaaacaaaggctc
ggagacgaagcaatcggcgtgcgacactttgcagcccatgagcgtgaagacttggtgcag
cagctagagcgagctaaggaacagattgagtctctggagcacgacctgcaggcttctgtg
gacgagcttcaggatgttaaagaagaacggtcttcctaccaggacaaagtggagaggctc
aaccaggagctgaaccatatcctgagtgggcacgagaaccgcatcattgacgtggacgcc
ctgtgtatggagaacaggtaccttcaagagagattaaagcaactccatgaagaggtcaac
ctcttgaaatcaaacattgccaaatacaagaatgctctggagagacggaaaaactcgaag
ggccagggtaaatccagcagcagtgctctgacaggagtcctgtctgcaaagcaagttcag
gatctgctatctgaggatcatggatgcagcctcccagctactccgcagtccatttctgac
ctgaaatctctggcaacagccctgttggaaacaatccacgagaaaaacatggtcattcag
caccagaggcaaaccaacaaaatcctagggaatcgggtggctgagctggaaaaaaaatta
agaactctggaagtttctggtttgtggagtcttccagggggcaaggacaccatactgttc
agcgaccccactcttcctagtggacagaggtcgagatccccactgctgaagtttgtcgag
cagcccactgagaacaaagcagatcccaaggatggggaggctcagaagcaagaagaagat
gaaagttgtgccgctgctgaggcgttgacagcgcctgaggatgctgggaggcccgctgtc
aactccccagcaaatcagagccgcgggaaccaatgcaagctctttcatccttcattaccc
cagttaccttctgaggaagaagtaaacagccttgggagggaaataattaaactgacaaag
gaacaggcagctgcagaactggaagaggtcagaagagagagtcccatagaaggtcagagg
agtgagacggggccagccccgccaggcctggccatccagggggagctccctaaatctcac
ctggactccttcgaggccagccggccagcagccaaagcttccacaccggaagacggcaaa
gggatcccagagggcggaggcatgaggagcaccgtgaaaacctga

DBGET integrated database retrieval system