KEGG   Homo sapiens (human): 91056
Entry
91056             CDS       T01001                                 

Gene name
AP5B1, AP-5, PP1030
Definition
(RefSeq) adaptor related protein complex 5 subunit beta 1
  KO
K19022  AP-5 complex subunit beta-1
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:hsa03400]
    91056 (AP5B1)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    AP-5 complex
     91056 (AP5B1)
SSDB
Other DBs
NCBI-GeneID: 91056
NCBI-ProteinID: NP_612377
OMIM: 614367
HGNC: 25104
Ensembl: ENSG00000254470
Vega: OTTHUMG00000166593
Pharos: Q2VPB7(Tdark)
UniProt: Q2VPB7
Position
11q13.1
AA seq 878 aa
MGPLSRDAWAQRLGAFRASPSAFMAGPEGEDLGRDLLSDLRSEKLSEQTKVSLLALSMEY
PAQLWPDASAAEVAATSLLDTLVLLPPRPSALRRPLLLAATTALAAGGALGPTSGASCRL
LPLLLGLAAGSDLGRGFVPASEQRPLQATACECLRELESCKPGLLGGSLGLLRGLLGQEG
PVQPLSLLLALALRNTLVLQSRVGAGLGGLLTDKVSPTGGGPWDWTLVEEGDGRLQPQAP
SWPAAEEGEGERSLTAREHSPEEARELRAAVIQLLDTSYLLTPVAQAQLLWLLGWALRGL
QGQPPALFKPQLVRLLGTAQLTLLHAMLALKAAFGEALFTAQDEALLLRRLTLAAQHPAL
PPPTHLFYLHCVLSFPENWPLGPEGEEAAPLLLGPQLCRGLLPSLLHDPMALLARLHLLC
LLCAEEEEEEKGQLPSPRHYLEELLAGLRQRAALDGGPRALATLCFQASYLVACCLAGQP
TVLTPLIHGLAQLYQARPMLAPHFVDLLDQVDSELREPLKVVLRQVVVSRPGRDEALCWH
LQMLAKVADGDAQSATLNFLQAAAAHCTNWDLQQGLLRVCRALLRAGVRGGLVDLLQVLA
RQLEDPDGRDHARLYYILLAHLAAPKLGVALGPSLAAPALASSLVAENQGFVAALMVQEA
PALVRLSLGSHRVKGPLPVLKLQPEALEPIYSLELRFRVEGQLYAPLEAVHVPCLCPGRP
ARPLLLPLQPRCPAPARLDVHALYTTSTGLTCHAHLPPLFVNFADLFLPFPQPPEGAGLG
FFEELWDSCLPEGAESRVWCPLGPQGLEGLVSRHLEPFVVVAQPPTSYCVAIHLPPDSKL
LLRLEAALADGVPVALRTDDWAVLPLAGDYLRGLAAAV
NT seq 2637 nt   +upstreamnt  +downstreamnt
atggggcccctgagccgggacgcctgggcccagcgcttgggggccttccgggccagcccg
tctgccttcatggcaggtcccgagggggaggatttgggtcgcgacctgctgagcgacctg
agaagtgagaagctgagcgaacagaccaaggtttccctgctggccctgagcatggagtac
cctgcgcagctgtggcccgacgcctctgcggccgaagtggccgccacctccctgttggac
accttggtcctcctacccccgcggccctcagctctccgtcggccactgctgctggcggcc
accactgccctggcggcgggcggcgcgctgggccccacctcgggcgcctcctgccggctc
ctgcccctactgctcggcctggccgcgggtagcgatctggggcgaggctttgtccccgcc
tcggaacagcgccccttgcaggccacggcctgcgagtgcctgcgagagctagagagctgc
aagcccgggctgctggggggctccctggggttgctgcggggcctgctggggcaggaaggc
cctgtccagccactcagcctgttgctggccctcgctttgcgcaacaccttggtgctccag
tcccgggttggggctggcctggggggactgctcacggataaggtctccccaactgggggt
ggtccctgggattggacactagtggaggagggcgatggacgccttcagccccaggcaccc
agctggccggcagctgaggagggagagggggagcgtagccttacagcacgagagcacagc
cctgaggaggcgcgggagctgcgggctgcggtgatccagcttctggacacctcctatctg
ctcactcctgtggcccaggcccagctcctgtggctgctgggctgggccctgcggggtctg
cagggacagccaccggcactcttcaagccgcagctggtacggctgctaggcacagcacag
ctgacactgttgcacgccatgcttgcgctcaaggcggcctttggtgaggccttgttcaca
gcccaggatgaagcgttgctgctccgccggctcaccttggctgcccagcaccctgctctg
cctccgcccacccatctcttttaccttcactgcgtcctgagcttccctgagaactggccg
ctgggccctgaaggtgaggaggctgccccactgctgctagggccccagctatgccgtggt
ctcctgcccagtctcctgcatgacccaatggccctcctggcccgcctgcatttactgtgc
ctgctctgtgccgaggaggaagaagaggagaaaggccagcttccaagcccacggcactac
ctggaagagctgctggctggcttgcggcagcgggcagccctggatgggggcccccgggcc
ttggccactctctgcttccaggcctcgtatctggtggcctgctgcctggctgggcaacct
acggtgctgacccccttgatccacggactggcccagctgtaccaagcccggcccatgctg
gctccccactttgtggacctcttggatcaggtggactctgagctgagggagcccctgaag
gtggtgttgcggcaggtggtggtgtccaggccgggcagggatgaagctctttgctggcac
ctgcaaatgctggcaaaggtggcagatggagatgcccagagtgctaccctcaactttcta
caggccgcggctgcccactgcacgaactgggacctacagcagggcctgctgcgggtctgc
cgggcgctgctgcgggcaggggtgaggggcggcctggtcgacttgctgcaggtgctggcc
aggcagctggaggaccctgatgggcgtgaccacgcccgcctctactacatcctgctggca
cacctggcagcacccaagttgggggtggccctgggcccctcgcttgccgcacctgcactg
gcctcttcactggtggccgagaaccagggctttgtggcagcactgatggtgcaggaggca
ccggccctggtacggctgagcctggggtcccatcgggtcaagggcccactcccagtgttg
aagctccagccggaggcgctggagcccatctactctctggagctgcgcttccgtgtggaa
ggacagctgtatgcacccctggaggctgtccatgtgccctgcctgtgtcctggccgccct
gcccgccctctgctcctgcctctgcagccccgatgcccggcccccgcacggctggatgtc
catgccctttacaccacatccactggtctcacgtgccatgcccacttgccacccctgttc
gtgaactttgccgacctctttctgcctttcccgcagcctccagagggggccgggctgggc
ttctttgaggagctctgggattcctgcctgccagagggtgctgagagtcgtgtgtggtgt
ccacttgggccacagggcctggagggcttggtgtcccgccacctggagccttttgtggtg
gtggcccagcctcctaccagctactgtgtagcaatccacctgcccccggactcaaagctg
ctgctgcggctggaggcggccctggcagatggagtgcctgtggccctgcggaccgatgac
tgggccgtgctgcccctggcgggggactacctccgtgggctggcggctgctgtctga

DBGET integrated database retrieval system