KEGG   Homo sapiens (human): 9107
Entry
9107              CDS       T01001                                 

Gene name
MTMR6
Definition
(RefSeq) myotubularin related protein 6
  KO
K18083  myotubularin-related protein 6/7/8 [EC:3.1.3.64 3.1.3.95]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00562  Inositol phosphate metabolism
hsa01100  Metabolic pathways
hsa04070  Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    9107 (MTMR6)
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    9107 (MTMR6)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:hsa01009]
    9107 (MTMR6)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.64  phosphatidylinositol-3-phosphatase
     9107 (MTMR6)
    3.1.3.95  phosphatidylinositol-3,5-bisphosphate 3-phosphatase
     9107 (MTMR6)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Myotubularins
    9107 (MTMR6)
SSDB
Motif
Pfam: Myotub-related Y_phosphatase DSPc Y_phosphatase3 GRAM
Other DBs
NCBI-GeneID: 9107
NCBI-ProteinID: NP_004676
OMIM: 603561
HGNC: 7453
Ensembl: ENSG00000139505
Vega: OTTHUMG00000016606
Pharos: Q9Y217(Tbio)
UniProt: Q9Y217
Structure
PDB: 
2YF0

Position
13q12.13
AA seq 621 aa
MEHIRTTKVEQVKLLDRFSTSNKSLTGTLYLTATHLLFIDSHQKETWILHHHIASVEKLA
LTTSGCPLVIQCKNFRTVHFIVPRERDCHDIYNSLLQLSKQAKYEDLYAFSYNPKQNDSE
RLQGWQLIDLAEEYKRMGVPNSHWQLSDANRDYKICETYPRELYVPRIASKPIIVGSSKF
RSKGRFPVLSYYHQDKEAAICRCSQPLSGFSARCLEDEHLLQAISKANPVNRYMYVMDTR
PKLNAMANRAAGKGYENEDNYSNIRFQFVGIENIHVMRSSLQKLLEVNGTKGLSVNDFYS
GLESSGWLRHIKAVMDAAIFLAKAITVENASVLVHCSDGWDRTSQVCSLGSLLLDSYYRT
IKGFMVLIEKDWISFGHKFSERCGQLDGDPKEVSPVFTQFLECVWHLTEQFPQAFEFSEA
FLLQIHEHIHSCQFGNFLGNCQKEREELKLKEKTYSLWPFLLEDQKKYLNPLYSSESHRF
TVLEPNTVSFNFKFWRNMYHQFDRTLHPRQSVFNIIMNMNEQNKQLEKDIKDLESKIKQR
KNKQTDGILTKELLHSVHPESPNLKTSLCFKEQTLLPVNDALRTIEGSSPADNRYSEYAE
EFSKSEPAVVSLEYGVARMTC
NT seq 1866 nt   +upstreamnt  +downstreamnt
atggagcatatccggacgaccaaggtcgaacaagtaaaattacttgaccgattcagtacc
agcaacaagtcattaacaggaacactgtatcttacggctacacatctattatttatcgac
tctcatcaaaaagaaacctggatattacaccaccatattgcctcagtagagaaacttgct
ttgactacttctggatgcccccttgtgatacagtgcaagaacttcagaactgtgcatttc
attgttcccagagaaagagattgccatgatatttacaactctttgctacaactgtcaaaa
caagcaaaatatgaagatctctatgcattttcttataatcccaaacaaaatgattcagaa
cgactacaaggctggcagctcattgatctcgctgaggaatataagaggatgggagtgcca
aactcacactggcagttgtctgatgccaaccgggactacaagatttgtgaaacttacccc
agagaactttatgttccccggatagcaagcaaaccaataattgttggtagttccaagttc
cggagcaagggaagattcccagttctttcctactatcatcaagataaggaggctgccatt
tgtcgatgtagtcagccactctctggattcagtgccaggtgcctggaggatgaacatttg
cttcaagccattagtaaagccaatccagtcaatcgctatatgtacgtcatggataccagg
ccaaaactgaatgcaatggccaacagagcagctggaaaaggttatgaaaatgaagacaac
tattccaatattagatttcagtttgttggaattgaaaatattcatgtcatgaggtccagc
cttcagaaattattggaagtcaatggcactaaagggctttctgtcaatgatttctactcc
ggtttggagagctcgggatggcttcgccatatcaaagctgttatggatgctgcaatcttc
ttggccaaagcaataacagttgaaaatgcaagtgtgttggtgcattgttccgatggttgg
gataggacttcccaggtttgttccctgggttctcttttattggattcctactacaggaca
atcaaaggattcatggttttaatagaaaaggattggatctcttttggacataaattttca
gagaggtgtggccagttggatggtgacccaaaggaagtctcaccagtgtttactcagttc
ttggaatgtgtgtggcatttgaccgaacagtttccacaagcctttgaattcagtgaagca
tttcttcttcagatccatgagcatattcattcatgccagtttggaaacttccttggaaat
tgtcagaaggaaagagaagagctcaagttgaaggagaagacttattccctgtggccattt
cttttggaagaccaaaagaagtacttaaatcctctctacagttccgaatctcacagattt
acagttttggagccaaatacagtatctttcaattttaagttttggaggaacatgtaccat
caatttgatcgaacactgcatcctaggcagtctgtatttaatataattatgaatatgaat
gagcaaaataaacaattagagaaagatattaaagacctagaatctaaaattaaacaacgc
aaaaataagcaaacagatggcatcctcaccaaggaattgttacattcagttcatcctgaa
tcacctaacctcaaaacttccctgtgttttaaagagcagactctgctacccgtaaatgat
gctcttcgaactatagagggcagcagcccggcagataatcgttatagtgaatatgcagaa
gagttttctaaatcagaacctgctgtggtcagcttagagtatggtgtggcaagaatgact
tgttag

DBGET integrated database retrieval system