KEGG   Homo sapiens (human): 9108Help
Entry
9108              CDS       T01001                                 

Gene name
MTMR7
Definition
(RefSeq) myotubularin related protein 7
  KO
K18083  myotubularin-related protein 6/7/8 [EC:3.1.3.64 3.1.3.95]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00562  Inositol phosphate metabolism
hsa01100  Metabolic pathways
hsa04070  Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    9108 (MTMR7)
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    9108 (MTMR7)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:hsa01009]
    9108 (MTMR7)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.64  phosphatidylinositol-3-phosphatase
     9108 (MTMR7)
    3.1.3.95  phosphatidylinositol-3,5-bisphosphate 3-phosphatase
     9108 (MTMR7)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Myotubularins
    9108 (MTMR7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Myotub-related GRAM DSPc Y_phosphatase CREPT Y_phosphatase3 DUF5320 FapA CCDC53
Motif
Other DBs
NCBI-GeneID: 9108
NCBI-ProteinID: NP_004677
OMIM: 603562
HGNC: 7454
Ensembl: ENSG00000003987
Vega: OTTHUMG00000163771
Pharos: Q9Y216(Tdark)
UniProt: Q9Y216 B7ZAG8 B7Z9Q7
Position
8p22
AA seq 660 aa AA seqDB search
MEHIRTPKVENVRLVDRVSPKKAALGTLYLTATHVIFVENSPDPRKETWILHSQISTIEK
QATTATGCPLLIRCKNFQIIQLIIPQERDCHDVYISLIRLARPVKYEELYCFSFNPMLDK
EEREQGWVLIDLSEEYTRMGLPNHYWQLSDVNRDYRVCDSYPTELYVPKSATAHIIVGSS
KFRSRRRFPVLSYYYKDNHASICRSSQPLSGFSARCLEDEQMLQAIRKANPGSDFVYVVD
TRPKLNAMANRAAGKGYENEDNYSNIKFQFIGIENIHVMRNSLQKMLEVCELKSPSMSDF
LWGLENSGWLRHIKAIMDAGIFIAKAVSEEGASVLVHCSDGWDRTAQVCSVASLLLDPHY
RTLKGFMVLIEKDWISFGHKFNHRYGNLDGDPKEISPVIDQFIECVWQLMEQFPCAFEFN
ERFLIHIQHHIYSCQFGNFLCNSQKERRELKIQERTYSLWAHLWKNRADYLNPLFRADHS
QTQGTLHLPTTPCNFMYKFWSGMYNRFEKGMQPRQSVTDYLMAVKEETQQLEEELEALEE
RLEKIQKVQLNCTKVKSKQSEPSKHSGFSTSDNSIANTPQDYSGNMKSFPSRSPSQGDED
SALILTQDNLKSSDPDLSANSDQESGVEDLSCRSPSGGEHAPSEDSGKDRDSDEAVFLTA
NT seq 1983 nt NT seq  +upstreamnt  +downstreamnt
atggagcacatccgtacgcccaaggttgaaaatgtccgcttggtagatcgagtgtctcct
aaaaaagcagctctaggtactttgtatttgacggctacccatgtcatattcgtggaaaat
tcacctgacccaagaaaagaaacatggattcttcacagtcagatttccaccattgagaaa
caggcaacaaccgctaccggatgccctctgctgattcgctgcaagaactttcagataata
cagctcatcatacctcaggaaagagattgccacgacgtgtacatctccctgatacgcctt
gcaaggccagtgaaatatgaggagttatactgcttttcattcaaccccatgctggataaa
gaagaaagagagcaaggctgggtgctgatcgatcttagtgaagaatacacgcggatgggc
ctccctaatcattactggcagctcagcgatgtgaatagagactacagagtctgtgactct
tatcctactgaactgtacgttcccaaatcggccacggcacacatcatagtggggagttcc
aaattccggagtagacggcgatttcctgtcctttcttactattataaagataaccacgcc
tccatctgccggagcagccagcccctgtccggcttcagtgcccggtgcctagaggacgag
cagatgctccaggccattaggaaagccaatccaggaagtgacttcgtttatgtcgttgac
acccggcctaaacttaatgcaatggcaaatcgtgctgcagggaaaggctatgagaatgaa
gacaattattccaatatcaagtttcagtttatcgggatagagaacatccatgtcatgagg
aacagtctgcagaaaatgctggaagtgtgtgaacttaaatctccctccatgagtgatttc
ctgtggggtctggagaactctggctggttaaggcacattaaagccataatggatgcagga
atcttcattgcaaaggcagtgtcagaggaaggggcaagtgtgcttgttcactgttctgat
ggctgggacaggaccgctcaggtgtgctcggtggcaagcctgctgctggaccctcactac
cggactctgaagggcttcatggtattaattgaaaaggactggatttcctttggtcataag
tttaatcaccgatatggcaatctagatggtgacccaaaagaaatctctccagttattgac
cagttcattgagtgtgtttggcagttaatggaacaatttccctgtgcctttgagttcaat
gagaggtttttgattcacattcaacatcacatttattcctgccagtttggaaacttccta
tgtaacagccaaaaggagagacgagaactcaagattcaagaaagaacatactcattatgg
gctcacctgtggaagaatcgggccgactacctgaatcctctgtttagagctgatcacagc
cagactcagggaacccttcatctccctacaacaccatgtaacttcatgtacaagttttgg
agtggaatgtataaccgctttgaaaaggggatgcagccccgacagtcagttacagattac
ctaatggcagtgaaggaagaaactcagcagctagaggaagaactagaggccctggaagaa
aggctggaaaaaattcaaaaggtccagttaaattgcactaaggtgaagagtaagcaaagt
gagcccagcaagcactcagggttttctacctcagacaacagcatagccaacactccccag
gattacagtgggaatatgaaatcatttccatcccggagcccttcacaaggcgatgaagat
tctgctctgattctaacccaagacaatctgaaaagttcagatccagatctgtcagccaac
agtgaccaagagtccggggtggaggatttgagctgtcggtctccaagtggtggtgagcat
gcaccgagtgaagatagtggcaaggaccgggattctgatgaagccgtgtttctcactgcc
tga

DBGET integrated database retrieval system