KEGG   Homo sapiens (human): 911Help
Entry
911               CDS       T01001                                 

Gene name
CD1C, BDCA1, CD1, CD1A, R7
Definition
(RefSeq) CD1c molecule
  KO
K06448  T-cell surface glycoprotein CD1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04530  Tight junction
hsa04640  Hematopoietic cell lineage
hsa05146  Amoebiasis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    911 (CD1C)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    911 (CD1C)
 09160 Human Diseases
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    911 (CD1C)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:hsa04090]
    911 (CD1C)
CD molecules [BR:hsa04090]
 Proteins
  911 (CD1C)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MHC_I_3 C1-set MHC_I Ig_3 Flp1_like
Motif
Other DBs
NCBI-GeneID: 911
NCBI-ProteinID: NP_001756
OMIM: 188340
HGNC: 1636
Ensembl: ENSG00000158481
Vega: OTTHUMG00000017514
Pharos: P29017(Tbio)
UniProt: P29017
Structure
PDB: 

Position
1q23.1
AA seq 333 aa AA seqDB search
MLFLQFLLLALLLPGGDNADASQEHVSFHVIQIFSFVNQSWARGQGSGWLDELQTHGWDS
ESGTIIFLHNWSKGNFSNEELSDLELLFRFYLFGLTREIQDHASQDYSKYPFEVQVKAGC
ELHSGKSPEGFFQVAFNGLDLLSFQNTTWVPSPGCGSLAQSVCHLLNHQYEGVTETVYNL
IRSTCPRFLLGLLDAGKMYVHRQVRPEAWLSSRPSLGSGQLLLVCHASGFYPKPVWVTWM
RNEQEQLGTKHGDILPNADGTWYLQVILEVASEEPAGLSCRVRHSSLGGQDIILYWGHHF
SMNWIALVVIVPLVILIVLVLWFKKHCSYQDIL
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgctgtttctgcagtttctgctgctagctcttcttctcccaggtggtgacaatgcagac
gcatcccaggaacacgtctccttccatgtcatccagatcttctcatttgtcaaccaatcc
tgggcacgaggtcagggctcaggatggctggacgagttgcagactcatggctgggacagt
gaatcaggcacaataattttcctgcataactggtccaagggcaacttcagcaatgaagag
ttgtcagacctagagttgttatttcgtttctacctctttggattaactcgggagattcaa
gaccatgcaagtcaagattactcgaaatatccctttgaagtacaggtgaaagcgggctgt
gagctgcattctggaaagagcccagaaggcttctttcaggtagctttcaacggattagat
ttactgagtttccagaatacaacatgggtgccatctccaggctgtggaagtttggcccaa
agtgtctgtcatctactcaatcatcagtatgaaggcgtcacagaaacagtgtataatctc
ataagaagcacttgcccccgatttctcttgggtctcctggatgcagggaagatgtatgta
cacaggcaagtgaggccagaagcctggctgtccagtcgccccagccttgggtctggccag
ctgttgctggtttgtcatgcctccggcttctacccaaagcctgtttgggtgacatggatg
cggaatgaacaggagcaactgggcactaaacatggtgatattcttcctaatgctgatggg
acatggtatcttcaggtgatcctggaggtggcatctgaggagcctgctggcctgtcttgt
cgagtgagacacagcagtctaggaggccaggacatcatcctctactggggacaccacttt
tccatgaattggattgccttggtagtgatagtgcccttggtgattctaatagtccttgtg
ttatggtttaagaagcactgctcatatcaggacatcctgtga

DBGET integrated database retrieval system