KEGG   Homo sapiens (human): 9110
Entry
9110              CDS       T01001                                 

Gene name
MTMR4, FYVE-DSP2, ZFYVE11
Definition
(RefSeq) myotubularin related protein 4
  KO
K18082  myotubularin-related protein 3/4 [EC:3.1.3.48 3.1.3.64 3.1.3.95]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00562  Inositol phosphate metabolism
hsa01100  Metabolic pathways
hsa04070  Phosphatidylinositol signaling system
hsa04140  Autophagy - animal
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    9110 (MTMR4)
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    9110 (MTMR4)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    9110 (MTMR4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:hsa01009]
    9110 (MTMR4)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     9110 (MTMR4)
    3.1.3.64  phosphatidylinositol-3-phosphatase
     9110 (MTMR4)
    3.1.3.95  phosphatidylinositol-3,5-bisphosphate 3-phosphatase
     9110 (MTMR4)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Myotubularins
    9110 (MTMR4)
SSDB
Motif
Pfam: Myotub-related FYVE Y_phosphatase DSPc Y_phosphatase3
Other DBs
NCBI-GeneID: 9110
NCBI-ProteinID: NP_004678
OMIM: 603559
HGNC: 7452
Ensembl: ENSG00000108389
Vega: OTTHUMG00000179079
Pharos: Q9NYA4(Tbio)
UniProt: Q9NYA4
Position
17q22
AA seq 1195 aa
MGEEGPPSLEYIQAKDLFPPKELVKEEENLQVPFTVLQGEGVEFLGRAADALIAISNYRL
HIKFKDSVINVPLRMIDSVESRDMFQLHISCKDSKVVRCHFSTFKQCQEWLSRLSRATAR
PAKPEDLFAFAYHAWCLGLTEEDQHTHLCQPGEHIRCRQEAELARMGFDLQNVWRVSHIN
SNYKLCPSYPQKLLVPVWITDKELENVASFRSWKRIPVVVYRHLRNGAAIARCSQPEISW
WGWRNADDEYLVTSIAKACALDPGTRATGGSLSTGNNDTSEACDADFDSSLTACSGVEST
AAPQKLLILDARSYTAAVANRAKGGGCECEEYYPNCEVVFMGMANIHAIRNSFQYLRAVC
SQMPDPSNWLSALESTKWLQHLSVMLKAAVLVANTVDREGRPVLVHCSDGWDRTPQIVAL
AKILLDPYYRTLEGFQVLVESDWLDFGHKFGDRCGHQENVEDQNEQCPVFLQWLDSVHQL
LKQFPCLFEFNEAFLVKLVQHTYSCLYGTFLANNPCEREKRNIYKRTCSVWALLRAGNKN
FHNFLYTPSSDMVLHPVCHVRALHLWTAVYLPASSPCTLGEENMDLYLSPVAQSQEFSGR
SLDRLPKTRSMDDLLSACDTSSPLTRTSSDPNLNNHCQEVRVGLEPWHSNPEGSETSFVD
SGVGGPQQTVGEVGLPPPLPSSQKDYLSNKPFKSHKSCSPSYKLLNTAVPREMKSNTSDP
EIKVLEETKGPAPDPSAQDELGRTLDGIGEPPEHCPETEAVSALSKVISNKCDGVCNFPE
SSQNSPTGTPQQAQPDSMLGVPSKCVLDHSLSTVCNPPSAACQTPLDPSTDFLNQDPSGS
VASISHQEQLSSVPDLTHGEEDIGKRGNNRNGQLLENPRFGKMPLELVRKPISQSQISEF
SFLGSNWDSFQGMVTSFPSGEATPRRLLSYGCCSKRPNSKQMRATGPCFGGQWAQREGVK
SPVCSSHSNGHCTGPGGKNQMWLSSHPKQVSSTKPVPLNCPSPVPPLYLDDDGLPFPTDV
IQHRLRQIEAGYKQEVEQLRRQVRELQMRLDIRHCCAPPAEPPMDYEDDFTCLKESDGSD
TEDFGSDHSEDCLSEASWEPVDKKETEVTRWVPDHMASHCYNCDCEFWLAKRRHHCRNCG
NVFCAGCCHLKLPIPDQQLYDPVLVCNSCYEHIQVSRARELMSQQLKKPIATASS
NT seq 3588 nt   +upstreamnt  +downstreamnt
atgggtgaggaggggccccccagcctggagtacatccaagccaaggatctgttccccccc
aaggaactagtgaaggaggaagagaatcttcaggtccccttcacagtgctgcagggtgag
ggagtagagttcctgggccgggcagccgatgccctcattgccatctctaactaccggctg
catatcaaattcaaggactctgtcatcaacgtccccctccggatgattgacagtgtggag
agccgtgatatgttccagttgcacatttcctgcaaggactccaaagtggtgaggtgccac
ttctccacttttaagcagtgccaagagtggctctcacggctaagccgagccacagcaaga
cctgccaagcctgaagacctctttgcctttgcctaccatgcctggtgcctggggctgacc
gaggaggaccagcacactcacctatgtcagccaggtgagcacatacgttgtcgacaggag
gcggagcttgcaaggatgggctttgacctgcagaacgtctggagagtctcacacatcaac
agcaactacaaattgtgccccagttacccccagaagctgctggttcctgtgtggatcact
gacaaagagctggagaacgtggcttccttccgctcctggaagcggattcccgtggttgtg
tatagacacttgcgcaatggggctgccatcgcccgctgcagccagccagagatcagctgg
tggggctggcgcaatgctgatgatgagtacctggtcacgtccattgctaaagcctgtgcc
ctggacccggggacaagggccactgggggctccctcagcaccgggaataatgataccagc
gaggcgtgtgatgctgactttgattcttctctgactgcgtgctctggagtggagagcaca
gcagctcctcaaaagctgctgatcctggatgcgcgatcctacacggcagcagtggccaac
cgggccaagggtggaggctgtgaatgtgaagagtactatcccaactgtgaggtcgtgttc
atgggaatggccaacatccatgccatccggaacagctttcagtacctccgggctgtgtgt
agccagatgccggatcctagcaactggttgtcggcactggagagtaccaaatggctgcag
cacttgtcggtgatgctaaaagcagctgtgctggtggctaatacagtagaccgggaaggc
cggcctgtgctggtacactgctcagatggctgggaccgcacaccgcagatcgtagccctg
gccaaaatattactggacccatattacaggacgttggagggcttccaagtgttagtggag
tctgactggctggattttgggcacaagtttggagatcgctgtggccaccaagagaatgtg
gaggaccaaaacgaacaatgccctgtgttcctccagtggcttgattctgttcatcagttg
cttaagcagttcccctgcctgtttgaatttaatgaagcattcctggtaaaactggtgcaa
cacacatactcctgcctctacggcaccttcctggccaacaacccctgtgagcgagagaag
cgcaacatctacaagcggacctgctctgtgtgggcgctccttcgagctggcaataaaaac
tttcataacttcctctacacacccagctcagacatggtcctgcatcctgtttgtcatgtc
cgggccctgcacctctggacagctgtttatctgccagcatcatctccatgcacacttggg
gaagaaaacatggatctttacctttccccagtggcccagagccaggagttctctggccgc
tctctggacagattacctaaaaccagatccatggatgatcttctttctgcctgtgacaca
agcagccccctgactcgtacatccagtgaccctaacctgaataaccactgtcaggaggtc
agggtaggcctggagccctggcacagcaatcctgagggatcagagacaagctttgtggac
tctggggtaggagggcctcagcaaactgtaggagaagtgggtcttcctcctcctctgccc
agcagccagaaagactacttgagcaataaacctttcaagagtcacaaaagctgttctcca
agttacaaactgcttaataccgcagtgcctcgggaaatgaagagcaacacctctgatcct
gagatcaaagtcctagaagagactaagggaccagctccagacccttctgcccaggatgag
ctgggtaggactttagatggcataggggagccacctgaacattgtcctgaaacagaagct
gtcagtgcactctccaaggtcatttctaacaagtgtgatggagtttgtaattttcctgag
tcttcccagaactctcctacaggtacgccccaacaggcccagccagactccatgctaggt
gtgccctccaagtgtgttcttgatcacagcctcagcaccgtttgcaacccaccgagtgct
gcctgccaaactcctctagacccaagcactgacttcctcaaccaagatccctcagggtct
gtggcaagtatctcccaccaggaacaactgagttctgtgccggatctgacccatggggag
gaagacattggtaaaagaggaaataataggaatgggcagttattggaaaatcctcgcttt
gggaaaatgccattggaattggtccggaagccaatttctcagagccagatcagtgagttc
tcttttctagggtccaactgggacagcttccaagggatggtgacttcattcccaagtggg
gaggccacccctcggcggctgctttcctatggctgttgtagcaagaggccaaacagtaag
cagatgcgggccacagggccctgctttgggggccagtgggctcagagagaaggtgtgaag
tcacctgtctgttctagtcattccaatggacattgtactggcccaggaggaaagaaccag
atgtggttgtccagtcatccaaagcaagtctctagcacaaagcccgttccactgaactgc
ccttctccagtgcctcctctgtatttggatgatgatggactcccctttcccacggatgtg
atccagcataggttacggcaaatcgaagcagggtacaaacaagaggtggagcagctacgt
cgacaggtgcgtgagcttcagatgaggctggacatccgtcactgctgtgcccctccagca
gagccccccatggactatgaggatgattttacatgtttgaaggagtcagatggcagtgat
actgaggattttggctctgatcacagtgaagactgcctttcagaagcaagctgggaacct
gttgataagaaagagactgaggtgactcgctgggttccagaccatatggcatcacactgc
tataactgtgactgtgaattctggttggccaaacgaagacaccattgcagaaattgtggg
aatgtattttgtgctggatgctgccacctgaagctgcccattcctgatcagcaactctat
gacccagttctcgtctgtaactcatgttacgaacacattcaagtctctcgtgccagggaa
ctcatgagccaacagctgaagaaacccattgctacagcttccagttga

DBGET integrated database retrieval system