KEGG   Homo sapiens (human): 9111
Entry
9111              CDS       T01001                                 
Symbol
NMI
Name
(RefSeq) N-myc and STAT interactor
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: NID IFP_35_N Cnn_1N MrpR_N_CB Siah-Interact_N UDPG_MGDP_dh_N PIH1_CS Peptidase_A3B CpG_bind_C
Other DBs
NCBI-GeneID: 9111
NCBI-ProteinID: NP_004679
OMIM: 603525
HGNC: 7854
Ensembl: ENSG00000123609
UniProt: Q13287
Position
2:complement(151270470..151289668)
AA seq 307 aa
MEADKDDTQQILKEHSPDEFIKDEQNKGLIDEITKKNIQLKKEIQKLETELQEATKEFQI
KEDIPETKMKFLSVETPENDSQLSNISCSFQVSSKVPYEIQKGQALITFEKEEVAQNVVS
MSKHHVQIKDVNLEVTAKPVPLNSGVRFQVYVEVSKMKINVTEIPDTLREDQMRDKLELS
FSKSRNGGGEVDRVDYDRQSGSAVITFVEIGVADKILKKKEYPLYINQTCHRVTVSPYTE
IHLKKYQIFSGTSKRTVLLTGMEGIQMDEEIVEDLINIHFQRAKNGGGEVDVVKCSLGQP
HIAYFEE
NT seq 924 nt   +upstreamnt  +downstreamnt
atggaagctgataaagatgacacacaacaaattcttaaggagcattcgccagatgaattt
ataaaagatgaacaaaataagggactaattgatgaaattacaaagaaaaatattcaacta
aagaaggagatccaaaagcttgaaacggagttacaagaggctaccaaagaattccagatt
aaagaggatattcctgaaacaaagatgaaattcttatcagttgaaactcctgagaatgac
agccagttgtcaaatatctcctgttcgtttcaagtgagctcgaaagttccttatgagata
caaaaaggacaagcacttatcacctttgaaaaagaagaagttgctcaaaatgtggtaagc
atgagtaaacatcatgtacagataaaagatgtaaatctggaggttacggccaagccagtt
ccattaaattcaggagtcagattccaggtttatgtagaagtttctaaaatgaaaatcaat
gttactgaaattcctgacacattgcgtgaagatcaaatgagagacaaactagagctgagc
ttttcaaagtcccgaaatggaggcggagaggtggaccgcgtggactatgacagacagtcc
gggagtgcagtcatcacgtttgtggagattggagtggctgacaagattttgaaaaagaaa
gaataccctctttatataaatcaaacctgccatagagttactgtttctccatacacagaa
atacacttgaaaaagtatcagatattttcaggaacatctaagaggacagtgcttctgaca
ggaatggaaggcattcaaatggatgaagaaattgtggaggatttaattaacattcacttt
caacgggcaaagaatggaggtggagaagtagatgtggtcaagtgttctctaggtcaacct
cacatagcatactttgaagaatag

DBGET integrated database retrieval system