KEGG   Homo sapiens (human): 9112Help
Entry
9112              CDS       T01001                                 

Gene name
MTA1
Definition
(RefSeq) metastasis associated 1
  KO
K11660  metastasis-associated protein MTA
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    9112 (MTA1)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Chromatin remodeling factors
   NuRD complex
    9112 (MTA1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MTA_R1 BAH ELM2 GATA Myb_DNA-binding Myb_DNA-bind_7
Motif
Other DBs
NCBI-GeneID: 9112
NCBI-ProteinID: NP_004680
OMIM: 603526
HGNC: 7410
Ensembl: ENSG00000182979
Vega: OTTHUMG00000150362
Pharos: Q13330(Tbio)
UniProt: Q13330 Q9BRL8
Structure
PDB: 

Position
14q32.33
AA seq 715 aa AA seqDB search
MAANMYRVGDYVYFENSSSNPYLIRRIEELNKTANGNVEAKVVCFYRRRDISSTLIALAD
KHATLSVCYKAGPGADNGEEGEIEEEMENPEMVDLPEKLKHQLRHRELFLSRQLESLPAT
HIRGKCSVTLLNETESLKSYLEREDFFFYSLVYDPQQKTLLADKGEIRVGNRYQADITDL
LKEGEEDGRDQSRLETQVWEAHNPLTDKQIDQFLVVARSVGTFARALDCSSSVRQPSLHM
SAAAASRDITLFHAMDTLHKNIYDISKAISALVPQGGPVLCRDEMEEWSASEANLFEEAL
EKYGKDFTDIQQDFLPWKSLTSIIEYYYMWKTTDRYVQQKRLKAAEAESKLKQVYIPNYN
KPNPNQISVNNVKAGVVNGTGAPGQSPGAGRACESCYTTQSYQWYSWGPPNMQCRLCASC
WTYWKKYGGLKMPTRLDGERPGPNRSNMSPHGLPARSSGSPKFAMKTRQAFYLHTTKLTR
IARRLCREILRPWHAARHPYLPINSAAIKAECTARLPEASQSPLVLKQAVRKPLEAVLRY
LETHPRPPKPDPVKSVSSVLSSLTPAKVAPVINNGSPTILGKRSYEQHNGVDGNMKKRLL
MPSRGLANHGQARHMGPSRNLLLNGKSYPTKVRLIRGGSLPPVKRRRMNWIDAPDDVFYM
ATEETRKIRKLLSSSETKRAARRPYKPIALRQSQALPPRPPPPAPVNDEPIVIED
NT seq 2148 nt NT seq  +upstreamnt  +downstreamnt
atggccgccaacatgtacagggtcggagactacgtctactttgagaactcctccagcaac
ccatacctgatccggagaatcgaggagctcaacaagacggccaatgggaacgtggaggcc
aaagtggtgtgcttctaccggaggcgggacatctccagcaccctcatcgccctggccgac
aagcacgcaaccctgtcagtctgctataaggccggaccgggggcggacaacggcgaggaa
ggggaaatagaagaggaaatggagaacccggaaatggtggacctgcccgagaaactaaag
caccagctgcggcatcgggagctgttcctctcccggcagctggagtctctgcccgccacg
cacatcaggggcaagtgcagcgtcaccctgctcaacgagaccgagtcgctcaagtcctac
ctggagcgggaggatttcttcttctattctctagtctacgacccacagcagaagaccctg
ctggcagataaaggagagattcgagtaggaaaccggtaccaggcagacatcaccgacttg
ttaaaagaaggcgaggaggatggccgagaccagtccaggttggagacccaggtgtgggag
gcgcacaacccactcacagacaagcagatcgaccagttcctggtggtggcccgctctgtg
ggcaccttcgcacgggccctggactgcagcagctccgtccgacagcccagcctgcacatg
agcgccgcagctgcctcccgagacatcaccctgttccacgccatggatactctccacaag
aacatctacgacatctccaaggccatctcggcgctggtgccgcagggcgggcccgtgctc
tgcagggacgagatggaggagtggtctgcatcagaggccaaccttttcgaggaagccctg
gaaaaatatgggaaggatttcacggacattcagcaagattttctcccgtggaagtcgctg
accagcatcattgagtactactacatgtggaagaccaccgacagatacgtgcagcagaaa
cgcttgaaagcagctgaagctgagagcaagttaaagcaagtttatattcccaactataac
aagccaaatccgaaccaaatcagcgtcaacaacgtcaaggccggtgtggtgaacggcacg
ggggcgccgggccagagccctggggctggccgggcctgcgagagctgttacaccacacag
tcttaccagtggtattcttggggtccccctaacatgcagtgtcgtctctgcgcatcttgt
tggacatattggaagaaatatggtggcttgaaaatgccaacccggttagatggagagagg
ccaggaccaaaccgcagtaacatgagtccccacggcctcccagcccggagcagcgggagc
cccaagtttgccatgaagaccaggcaggctttctatctgcacacgacgaagctgacgcgg
atcgcccggcgcctgtgccgtgagatcctgcgcccgtggcacgctgcgcggcacccctac
ctgcccatcaacagcgcggccatcaaggccgagtgcacggcgcggctgcccgaagcctcc
cagagcccgctggtgctgaagcaggcggtacgcaagccgctggaagccgtgcttcggtat
cttgagacccacccccgcccccccaagcctgaccccgtgaaaagcgtgtccagcgtgctc
agcagcctgacgcccgccaaggtggcccccgtcatcaacaacggctcccccaccatcctg
ggcaagcgcagctacgagcagcacaacggggtggacggcaacatgaagaagcgcctcttg
atgcccagtaggggtctggcaaaccacggacaggccaggcacatgggaccaagccggaac
ctcctgctcaacgggaagtcctaccccaccaaagtgcgcctgatccgggggggctccctg
cccccagtcaagcggcggcggatgaactggatcgacgccccggatgacgtgttctacatg
gccacagaggagaccaggaagatccgcaagctgctctcatcctcggaaaccaagcgtgct
gcccgccggccctacaagcccatcgccctgcgccagagccaggccctgccgccgcggcca
ccgccacctgcgcccgtcaacgacgagcccatcgtcatcgaggactag

DBGET integrated database retrieval system