KEGG   Homo sapiens (human): 9113Help
Entry
9113              CDS       T01001                                 

Gene name
LATS1, WARTS, wts
Definition
(RefSeq) large tumor suppressor kinase 1
  KO
K08791  serine/threonine-protein kinase LATS1/2 [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04390  Hippo signaling pathway
hsa04392  Hippo signaling pathway - multiple species
Module
hsa_M00683  Hippo signaling
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04390 Hippo signaling pathway
    9113 (LATS1)
   04392 Hippo signaling pathway - multiple species
    9113 (LATS1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     9113 (LATS1)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: AGC group
  NDR family
   9113 (LATS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr UBA Haspin_kinase Kinase-like APH Cas_Cas6 Pkinase_C UBA_3
Motif
Other DBs
NCBI-GeneID: 9113
NCBI-ProteinID: NP_004681
OMIM: 603473
HGNC: 6514
Ensembl: ENSG00000131023
Vega: OTTHUMG00000016437
Pharos: O95835(Tbio)
UniProt: O95835
Structure
PDB: 

Position
6q25.1
AA seq 1130 aa AA seqDB search
MKRSEKPEGYRQMRPKTFPASNYTVSSRQMLQEIRESLRNLSKPSDAAKAEHNMSKMSTE
DPRQVRNPPKFGTHHKALQEIRNSLLPFANETNSSRSTSEVNPQMLQDLQAAGFDEDMVI
QALQKTNNRSIEAAIEFISKMSYQDPRREQMAAAAARPINASMKPGNVQQSVNRKQSWKG
SKESLVPQRHGPPLGESVAYHSESPNSQTDVGRPLSGSGISAFVQAHPSNGQRVNPPPPP
QVRSVTPPPPPRGQTPPPRGTTPPPPSWEPNSQTKRYSGNMEYVISRISPVPPGAWQEGY
PPPPLNTSPMNPPNQGQRGISSVPVGRQPIIMQSSSKFNFPSGRPGMQNGTGQTDFMIHQ
NVVPAGTVNRQPPPPYPLTAANGQSPSALQTGGSAAPSSYTNGSIPQSMMVPNRNSHNME
LYNISVPGLQTNWPQSSSAPAQSSPSSGHEIPTWQPNIPVRSNSFNNPLGNRASHSANSQ
PSATTVTAITPAPIQQPVKSMRVLKPELQTALAPTHPSWIPQPIQTVQPSPFPEGTASNV
TVMPPVAEAPNYQGPPPPYPKHLLHQNPSVPPYESISKPSKEDQPSLPKEDESEKSYENV
DSGDKEKKQITTSPITVRKNKKDEERRESRIQSYSPQAFKFFMEQHVENVLKSHQQRLHR
KKQLENEMMRVGLSQDAQDQMRKMLCQKESNYIRLKRAKMDKSMFVKIKTLGIGAFGEVC
LARKVDTKALYATKTLRKKDVLLRNQVAHVKAERDILAEADNEWVVRLYYSFQDKDNLYF
VMDYIPGGDMMSLLIRMGIFPESLARFYIAELTCAVESVHKMGFIHRDIKPDNILIDRDG
HIKLTDFGLCTGFRWTHDSKYYQSGDHPRQDSMDFSNEWGDPSSCRCGDRLKPLERRAAR
QHQRCLAHSLVGTPNYIAPEVLLRTGYTQLCDWWSVGVILFEMLVGQPPFLAQTPLETQM
KVINWQTSLHIPPQAKLSPEASDLIIKLCRGPEDRLGKNGADEIKAHPFFKTIDFSSDLR
QQSASYIPKITHPTDTSNFDPVDPDKLWSDDNEEENVNDTLNGWYKNGKHPEHAFYEFTF
RRFFDDNGYPYNYPKPIEYEYINSQGSEQQSDEDDQNTGSEIKNRDLVYV
NT seq 3393 nt NT seq  +upstreamnt  +downstreamnt
atgaagaggagtgaaaagccagaaggatatagacaaatgaggcctaagacctttcctgcc
agtaactatactgtcagtagccggcaaatgttacaagaaattcgggaatcccttaggaat
ttatctaaaccatctgatgctgctaaggctgagcataacatgagtaaaatgtcaaccgaa
gatcctcgacaagtcagaaatccacccaaatttgggacgcatcataaagccttgcaggaa
attcgaaactctctgcttccatttgcaaatgaaacaaattcttctcggagtacttcagaa
gttaatccacaaatgcttcaagacttgcaagctgctggatttgatgaggatatggttata
caagctcttcagaaaactaacaacagaagtatagaagcagcaattgaattcattagtaaa
atgagttaccaagatcctcgacgagagcagatggctgcagcagctgccagacctattaat
gccagcatgaaaccagggaatgtgcagcaatcagttaaccgcaaacagagctggaaaggt
tctaaagaatccttagttcctcagaggcatggcccgccactaggagaaagtgtggcctat
cattctgagagtcccaactcacagacagatgtaggaagacctttgtctggatctggtata
tcagcatttgttcaagctcaccctagcaacggacagagagtgaaccccccaccaccacct
caagtaaggagtgttactcctccaccacctccaagaggccagactccccctccaagaggt
acaactccacctcccccttcatgggaaccaaactctcaaacaaagcgctattctggaaac
atggaatacgtaatctcccgaatctctcctgtcccacctggggcatggcaagagggctat
cctccaccacctctcaacacttcccccatgaatcctcctaatcaaggacagagaggcatt
agttctgttcctgttggcagacaaccaatcatcatgcagagttctagcaaatttaacttt
ccatcagggagacctggaatgcagaatggtactggacaaactgatttcatgatacaccaa
aatgttgtccctgctggcactgtgaatcggcagccaccacctccatatcctctgacagca
gctaatggacaaagcccttctgctttacaaacagggggatctgctgctccttcgtcatat
acaaatggaagtattcctcagtctatgatggtgccaaacagaaatagtcataacatggaa
ctatataacattagtgtacctggactgcaaacaaattggcctcagtcatcttctgctcca
gcccagtcatccccgagcagtgggcatgaaatccctacatggcaacctaacataccagtg
aggtcaaattcttttaataacccattaggaaatagagcaagtcactctgctaattctcag
ccttctgctacaacagtcactgcaattacaccagctcctattcaacagcctgtgaaaagt
atgcgtgtattaaaaccagagctacagactgctttagcacctacacacccttcttggata
ccacagccaattcaaactgttcaacccagtccttttcctgagggaaccgcttcaaatgtg
actgtgatgccacctgttgctgaagctccaaactatcaaggaccaccaccaccctaccca
aaacatctgctgcaccaaaacccatctgttcctccatacgagtcaatcagtaagcctagc
aaagaggatcagccaagcttgcccaaggaagatgagagtgaaaagagttatgaaaatgtt
gatagtggggataaagaaaagaaacagattacaacttcacctattactgttaggaaaaac
aagaaagatgaagagcgaagggaatctcgtattcaaagttattctcctcaagcatttaaa
ttctttatggagcaacatgtagaaaatgtactcaaatctcatcagcagcgtctacatcgt
aaaaaacaattagagaatgaaatgatgcgggttggattatctcaagatgcccaggatcaa
atgagaaagatgctttgccaaaaagaatctaattacatccgtcttaaaagggctaaaatg
gacaagtctatgtttgtgaagataaagacactaggaataggagcatttggtgaagtctgt
ctagcaagaaaagtagatactaaggctttgtatgcaacaaaaactcttcgaaagaaagat
gttcttcttcgaaatcaagtcgctcatgttaaggctgagagagatatcctggctgaagct
gacaatgaatgggtagttcgtctatattattcattccaagataaggacaatttatacttt
gtaatggactacattcctgggggtgatatgatgagcctattaattagaatgggcatcttt
ccagaaagtctggcacgattctacatagcagaacttacctgtgcagttgaaagtgttcat
aaaatgggttttattcatagagatattaaacctgataatattttgattgatcgtgatggt
catattaaattgactgactttggcctctgcactggcttcagatggacacacgattctaag
tactatcagagtggtgaccatccacggcaagatagcatggatttcagtaatgaatggggg
gatccctcaagctgtcgatgtggagacagactgaagccattagagcggagagctgcacgc
cagcaccagcgatgtctagcacattctttggttgggactcccaattatattgcacctgaa
gtgttgctacgaacaggatacacacagttgtgtgattggtggagtgttggtgttattctt
tttgaaatgttggtgggacaacctcctttcttggcacaaacaccattagaaacacaaatg
aaggttatcaactggcaaacatctcttcacattccaccacaagctaaactcagtcctgaa
gcttctgatcttattattaaactttgccgaggacccgaagatcgcttaggcaagaatggt
gctgatgaaataaaagctcatccattttttaaaacaattgacttctccagtgacctgaga
cagcagtctgcttcatacattcctaaaatcacacacccaacagatacatcaaattttgat
cctgttgatcctgataaattatggagtgatgataacgaggaagaaaatgtaaatgacact
ctcaatggatggtataaaaatggaaagcatcctgaacatgcattctatgaatttaccttc
cgaaggttttttgatgacaatggctacccatataattatccgaagcctattgaatatgaa
tacattaattcacaaggctcagagcagcagtcggatgaagatgatcaaaacacaggctca
gagattaaaaatcgcgatctagtatatgtttaa

DBGET integrated database retrieval system