KEGG   Homo sapiens (human): 91133Help
Entry
91133             CDS       T01001                                 

Gene name
L3MBTL4, HsT1031
Definition
(RefSeq) L3MBTL histone methyl-lysine binding protein 4
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: MBT SAM_1 zf-C2HC SAM_2 SAM_PNT SAM_Ste50p Tudor-knot
Motif
Other DBs
NCBI-GeneID: 91133
NCBI-ProteinID: NP_775735
OMIM: 617135
HGNC: 26677
Ensembl: ENSG00000154655
Vega: OTTHUMG00000178980
Pharos: Q8NA19(Tdark)
UniProt: Q8NA19
Position
18p11.31
AA seq 623 aa AA seqDB search
MKQPNRKRKLNMDSKERLDQDGRLEQAEEEKKPKDSTTPLSHVPSAAAQGAWSWEWYLKE
QKAVAAPVELFSKDQSFPEHENGFQIGMRLEGIDPRHPSVFCVLSVAEVCGYRLRLHFDG
YLSCYDFWTNAGSPDIHPVGWCEKTKHELHIPKGYRKDKFVWMDYLKACKLQNAPKKLFR
NRSPNGPMSKEFQVGMKLEAVDRKNPSLVCVATIADIVEDRLLVHFDNWDDSYDYWCDVN
SPYVQPVGWCQENGRTLIAPQGYPNPENFSWTEYLEATQTNAVPAKVFKMRLPHGFLPNM
KLEVVDKRNPRLIRVATIVDVDDQRVKVHFDGWDHKYDYWVEADSPDIHPIGWCDVTGHP
LEVPQRTNDLKILPGQAVCPTPGCRGIGHIRGPRYSGHHSAFGCPYSDMNLKKEATLHDR
LREQTQANLESDSSHSKSKSLCSLNFNGKHEKVNSQPRLVQQAKCLKIKGKEDIDLDNLF
RVLVLHPRGLEYSVEQAQQVLHQSVSMSTVSAHPFRDLPLGREQHCKLLPGVADIRASQV
ARWTVDEVAEFVQSLLGCEEHAKCFKKEQIDGKAFLLLTQTDIVKVMKIKLGPALKIYNS
ILMFRHSQELPEEDIASGQEVRG
NT seq 1872 nt NT seq  +upstreamnt  +downstreamnt
atgaaacagcccaacaggaaaaggaagcttaatatggattccaaagagcgtttggatcag
gacggacgcttggagcaagctgaagaggaaaagaagcccaaggatagcacaacccctttg
agtcacgtcccttcagcggctgcacagggagcatggtcttgggagtggtacttgaaagaa
cagaaggctgtcgcagcacctgttgagctgttttccaaggatcagtcctttccagagcat
gaaaatggttttcagattggaatgagattagaaggcattgatccccgacatccatcggta
ttctgtgtgctttctgtagcggaggtttgtggttaccgtctaagacttcattttgatggt
tatttaagttgctatgatttttggaccaatgctggttcccctgacattcatccagtagga
tggtgtgaaaagaccaaacatgaactgcacatccctaagggttatagaaaagataaattt
gtttggatggattacttgaaggcctgcaaattgcaaaatgctccaaagaaattattcaga
aacagaagtcctaatgggccaatgtctaaagaatttcaggttggaatgaagctggaggcc
gtggacaggaagaacccttccttggtgtgtgtggcgaccatagcagatattgttgaagat
cgcttactagtgcattttgacaactgggatgatagttacgattactggtgcgatgttaat
agcccttatgtccagccagttggttggtgtcaggagaatggaagaactctgatagcaccc
caaggttatcccaatccagaaaatttttcctggacagaatacctggaagctactcaaacc
aatgcagttcctgccaaagtttttaaaatgaggttgcctcatggttttctgccaaatatg
aaacttgaagttgtggataaacggaaccccaggttaattcgtgttgctacgattgtagat
gttgatgaccaaagagtaaaggttcattttgatggttgggaccataagtatgactactgg
gtggaggcagacagccctgatatccacccgatcggatggtgtgatgtcacagggcatcca
ctggaagtgccacagcgaacgaatgacctgaagatccttccaggtcaagctgtctgtcct
actcccgggtgccgaggaataggccatatccgtggtccacgttattcgggacatcacagt
gcttttggctgcccgtattcagacatgaacttgaaaaaggaggcaacacttcacgatcgt
ttgagagaacaaacacaggcaaatttggaatcagactcttcacattcaaaatcaaaaagc
ctctgtagtttgaacttcaatggaaaacatgaaaaggtgaacagtcagcccagacttgta
cagcaggcaaagtgtttgaaaatcaaaggaaaagaagatattgacttggataatctcttc
agagtgcttgtgctgcatcccagaggtttggaatactcggtggagcaggcgcagcaggtg
cttcaccagtcagtgtccatgtccacggtgtcagcccacccttttcgggaccttcccctc
ggcagggagcaacactgcaagttgcttccaggcgtggctgacatccgggccagccaagtg
gcacgttggactgtggatgaggtggctgagtttgtacagtctcttctgggctgtgaagag
catgccaagtgctttaagaaagagcagatcgatggcaaagccttcctgcttctgacacag
acggacattgtcaaagtgatgaagatcaaactgggcccagcactgaagatttacaactct
atcctgatgttcaggcattcccaggaactccctgaagaagatattgcctcaggccaagaa
gtcaggggatga

DBGET integrated database retrieval system