KEGG   Homo sapiens (human): 91137Help
Entry
91137             CDS       T01001                                 

Gene name
SLC25A46, HMSN6B
Definition
(RefSeq) solute carrier family 25 member 46
  KO
K03454  solute carrier family 25, member 46
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    91137 (SLC25A46)
Transporters [BR:hsa02000]
 Solute Carrier Family (SLC)
  SLC25: Mitochondrial carrier
   91137 (SLC25A46)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Mito_carr
Motif
Other DBs
NCBI-GeneID: 91137
NCBI-ProteinID: NP_620128
OMIM: 610826
HGNC: 25198
Ensembl: ENSG00000164209
Vega: OTTHUMG00000128794
Pharos: Q96AG3(Tbio)
UniProt: Q96AG3
Position
5q22.1
AA seq 418 aa AA seqDB search
MHPRRPDGFDGLGYRGGARDEQGFGGAFPARSFSTGSDLGHWVTTPPDIPGSRNLHWGEK
SPPYGVPTTSTPYEGPTEEPFSSGGGGSVQGQSSEQLNRFAGFGIGLASLFTENVLAHPC
IVLRRQCQVNYHAQHYHLTPFTVINIMYSFNKTQGPRALWKGMGSTFIVQGVTLGAEGII
SEFTPLPREVLHKWSPKQIGEHLLLKSLTYVVAMPFYSASLIETVQSEIIRDNTGILECV
KEGIGRVIGMGVPHSKRLLPLLSLIFPTVLHGVLHYIISSVIQKFVLLILKRKTYNSHLA
ESTSPVQSMLDAYFPELIANFAASLCSDVILYPLETVLHRLHIQGTRTIIDNTDLGYEVL
PINTQYEGMRDCINTIRQEEGVFGFYKGFGAVIIQYTLHAAVLQITKIIYSTLLQNNI
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atgcatccgcggcgcccggacggatttgatggcttgggctaccggggtggtgcccgggac
gagcagggctttggcggcgccttccctgcaaggtccttcagcaccgggtcggacctgggc
cactgggtgacgactcccccagatatccccggcagccgcaacctgcactggggcgagaag
agcccgccctacggcgtgcccaccacctccaccccgtacgaaggccccacggaggaaccc
ttttccagtggcggcggcggcagtgtgcaggggcagagcagtgaacagctgaatagattt
gctggatttggtattggacttgcaagtctctttacagaaaatgtattggcacatccttgc
attgttctacgccgccaatgtcaggttaattaccatgctcagcattaccatctcactcca
tttacagtcatcaatattatgtacagtttcaacaaaactcagggacctagagccctgtgg
aaaggaatgggaagtacatttattgtccagggagtcacacttggagcagaaggcataatt
agtgaatttacacctttgccaagggaggttttacataaatggagtcctaaacaaatagga
gaacaccttctactgaaatccctaacttacgtggtggcaatgcctttttattcagcaagt
ctgattgaaacagtgcagagtgagataattcgagataatactggcattttggagtgtgtt
aaagaaggaattggaagagtgataggcatgggagtgcctcatagcaaacgacttcttccg
cttctttccttgatcttccctacggtgcttcatggagttcttcattacatcatcagctca
gttattcagaagtttgtcctactaattctaaagagaaagacttacaatagccacctagct
gagagcactagccctgtgcagagtatgttggatgcttattttccagaacttattgctaac
tttgctgccagtctttgttctgacgttatactttacccattggaaacagttttgcaccgc
cttcacattcaaggaacacgcacaataattgacaatacagaccttggctatgaagtgctt
ccaattaatacacaatatgagggaatgagagactgtatcaataccataaggcaggaggaa
ggagtgtttggtttttataaagggtttggtgctgttataatacagtacacactgcatgca
gctgttttacagattaccaaaattatttactctacacttcttcaaaataacatttga

DBGET integrated database retrieval system