KEGG   Homo sapiens (human): 9114Help
Entry
9114              CDS       T01001                                 

Gene name
ATP6V0D1, ATP6D, ATP6DV, P39, VATX, VMA6, VPATPD
Definition
(RefSeq) ATPase H+ transporting V0 subunit d1
  KO
K02146  V-type H+-transporting ATPase subunit d
Organism
hsa  Homo sapiens (human)
Pathway
hsa00190  Oxidative phosphorylation
hsa01100  Metabolic pathways
hsa04142  Lysosome
hsa04145  Phagosome
hsa04721  Synaptic vesicle cycle
hsa04966  Collecting duct acid secretion
hsa05110  Vibrio cholerae infection
hsa05120  Epithelial cell signaling in Helicobacter pylori infection
hsa05152  Tuberculosis
hsa05165  Human papillomavirus infection
hsa05203  Viral carcinogenesis
hsa05323  Rheumatoid arthritis
Module
hsa_M00160  V-type ATPase, eukaryotes
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    9114 (ATP6V0D1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    9114 (ATP6V0D1)
   04142 Lysosome
    9114 (ATP6V0D1)
 09150 Organismal Systems
  09155 Excretory system
   04966 Collecting duct acid secretion
    9114 (ATP6V0D1)
  09156 Nervous system
   04721 Synaptic vesicle cycle
    9114 (ATP6V0D1)
 09160 Human Diseases
  09161 Cancers: Overview
   05203 Viral carcinogenesis
    9114 (ATP6V0D1)
  09163 Immune diseases
   05323 Rheumatoid arthritis
    9114 (ATP6V0D1)
  09171 Infectious diseases: Bacterial
   05110 Vibrio cholerae infection
    9114 (ATP6V0D1)
   05120 Epithelial cell signaling in Helicobacter pylori infection
    9114 (ATP6V0D1)
   05152 Tuberculosis
    9114 (ATP6V0D1)
  09172 Infectious diseases: Viral
   05165 Human papillomavirus infection
    9114 (ATP6V0D1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: vATP-synt_AC39 Nab2p_Zf1
Motif
Other DBs
NCBI-GeneID: 9114
NCBI-ProteinID: NP_004682
OMIM: 607028
HGNC: 13724
Ensembl: ENSG00000159720
Vega: OTTHUMG00000137515
Pharos: P61421(Tbio)
UniProt: P61421
Position
16q22.1
AA seq 351 aa AA seqDB search
MSFFPELYFNVDNGYLEGLVRGLKAGVLSQADYLNLVQCETLEDLKLHLQSTDYGNFLAN
EASPLTVSVIDDRLKEKMVVEFRHMRNHAYEPLASFLDFITYSYMIDNVILLITGTLHQR
SIAELVPKCHPLGSFEQMEAVNIAQTPAELYNAILVDTPLAAFFQDCISEQDLDEMNIEI
IRNTLYKAYLESFYKFCTLLGGTTADAMCPILEFEADRRAFIITINSFGTELSKEDRAKL
FPHCGRLYPEGLAQLARADDYEQVKNVADYYPEYKLLFEGAGSNPGDKTLEDRFFEHEVK
LNKLAFLNQFHFGVFYAFVKLKEQECRNIVWIAECIAQRHRAKIDNYIPIF
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgtcgttcttcccggagctttactttaacgtggacaatggctacttggagggactggtg
cgcggcctgaaggccggggtgctcagccaggccgactacctcaacctggtgcagtgcgag
acgctagaggacttgaaactgcatctgcagagcactgattatggtaacttcctggccaac
gaggcatcacctctgacggtgtcagtcatcgatgaccggctcaaggagaagatggtggtg
gagttccgccacatgaggaaccatgcctatgagccactcgccagcttcctagacttcatt
acttacagttacatgatcgacaacgtgatcctgctcatcacaggcacgctgcaccagcgc
tccatcgctgagctcgtgcccaagtgccacccactaggcagcttcgagcagatggaggcc
gtgaacattgctcagacacctgctgagctctacaatgccattctggtggacacgcctctt
gcggcttttttccaggactgcatttcagagcaggaccttgacgagatgaacatcgagatc
atccgcaacaccctctacaaggcctacctggagtccttctacaagttctgcaccctactg
ggcgggactacggctgatgccatgtgccccatcctggagtttgaagcagaccgccgcgcc
ttcatcatcaccatcaattctttcggcacagagctgtccaaagaggaccgtgccaagctc
tttccacactgtgggcggctctaccctgagggcctggcgcagctggctcgggctgacgac
tatgaacaggtcaagaacgtggccgattactacccggagtacaagctgctcttcgagggt
gcaggtagcaaccctggagacaagacgctggaggaccgattctttgagcacgaggtaaag
ctgaacaagttggccttcctgaaccagttccactttggtgtcttctatgccttcgtgaag
ctcaaggagcaggagtgtcgcaacatcgtgtggatcgctgaatgtatcgcccagcgccac
cgcgccaaaatcgacaactacatccctatcttctag

DBGET integrated database retrieval system