KEGG   Homo sapiens (human): 9118Help
Entry
9118              CDS       T01001                                 

Gene name
INA, NEF5, NF-66, TXBP-1
Definition
(RefSeq) internexin neuronal intermediate filament protein alpha
  KO
K07608  internexin neuronal intermediate filament protein, alpha
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    9118 (INA)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Intermediate filaments
   Intermediate filaments
    Type IV
     9118 (INA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Filament Filament_head CCDC144C DUF1664 TolA_bind_tri
Motif
Other DBs
NCBI-GeneID: 9118
NCBI-ProteinID: NP_116116
OMIM: 605338
HGNC: 6057
Ensembl: ENSG00000148798
Vega: OTTHUMG00000018986
Pharos: Q16352(Tbio)
UniProt: Q16352
Position
10q24.33
AA seq 499 aa AA seqDB search
MSFGSEHYLCSSSSYRKVFGDGSRLSARLSGAGGAGGFRSQSLSRSNVASSAACSSASSL
GLGLAYRRPPASDGLDLSQAAARTNEYKIIRTNEKEQLQGLNDRFAVFIEKVHQLETQNR
ALEAELAALRQRHAEPSRVGELFQRELRDLRAQLEEASSARSQALLERDGLAEEVQRLRA
RCEEESRGREGAERALKAQQRDVDGATLARLDLEKKVESLLDELAFVRQVHDEEVAELLA
TLQASSQAAAEVDVTVAKPDLTSALREIRAQYESLAAKNLQSAEEWYKSKFANLNEQAAR
STEAIRASREEIHEYRRQLQARTIEIEGLRGANESLERQILELEERHSAEVAGYQDSIGQ
LENDLRNTKSEMARHLREYQDLLNVKMALDIEIAAYRKLLEGEETRFSTSGLSISGLNPL
PNPSYLLPPRILSATTSKVSSTGLSLKKEEEEEEASKVASKKTSQIGESFEEILEETVIS
TKKTEKSNIEETTISSQKI
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgagcttcggctcggagcactacctgtgctcctcctcctcctaccgcaaggtgttcggg
gatggctctcgcctgtccgcccgcctctctggggccggcggcgcgggcggcttccgctcg
cagtcgctgtcccgcagcaatgtggcctcctcggccgcctgctcctcggcctcgtcgctc
ggcctcggcctggcctatcgccggccgccggcgtccgacgggctggacctgagccaggcg
gcggcgcgcaccaacgagtacaagatcatccgcaccaacgagaaggagcagctgcagggc
ctcaacgaccgcttcgccgtgttcatcgagaaggtgcatcagctggagacgcagaaccgc
gcgttggaggccgagctggccgcgctgcgacagcgccacgctgagccgtcgcgcgtcggc
gagctcttccagcgcgagctgcgcgacctgcgcgcgcagctggaggaggccagctcggct
cgctcgcaggccctgctggagcgcgacgggctggcggaggaggtgcagcggctgcgggcg
cgctgcgaggaggagagccgcggacgcgaaggcgccgagcgcgccctgaaggcgcagcag
cgcgacgtggacggcgccacgctggcccgcctggacctggagaagaaggtggagtcgctg
ctggacgagctggccttcgtacgccaggtgcacgacgaggaggtagccgagctgctggcc
acgctgcaggcgtcgtcgcaggccgcggccgaggtggacgtgactgtggctaaaccagac
ctgacctcggctctgagggagatccgcgcccagtatgagtccctggccgctaagaacctg
cagtccgcggaagaatggtacaagtccaagtttgccaacctgaacgagcaggcggcgcgc
agcaccgaggccatccgggccagccgcgaggagatccacgagtatcggcgccagctgcag
gcgcgcaccatcgagatcgagggcctgcgcggggccaacgagtccttggagaggcagatc
ctggagctggaggagcggcacagtgccgaggtagctggctaccaggatagcattgggcag
ctggagaatgatctgaggaacaccaagagtgagatggcacgccaccttcgggaataccag
gacttgctcaatgtcaaaatggctcttgacattgagatagcagcttacaggaaactgctg
gaaggcgaggagacacgttttagcaccagtgggttaagcatttcggggctgaatccactt
cccaatccaagttacctgctcccacctagaatcctcagtgctacaacctccaaagtctca
tccactgggctatcacttaagaaagaggaggaggaggaggaggcatctaaggtagcctct
aagaaaacctcccagataggggaaagttttgaagaaatattagaggagacagtaatatct
actaagaaaaccgagaaatcaaatatagaagaaaccaccatttcaagccaaaaaatataa

DBGET integrated database retrieval system