KEGG   Homo sapiens (human): 912
Entry
912               CDS       T01001                                 

Gene name
CD1D, CD1A, R3, R3G1
Definition
(RefSeq) CD1d molecule
  KO
K06448  T-cell surface glycoprotein CD1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04530  Tight junction
hsa04640  Hematopoietic cell lineage
hsa05146  Amoebiasis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    912 (CD1D)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    912 (CD1D)
 09160 Human Diseases
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    912 (CD1D)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:hsa04090]
    912 (CD1D)
CD molecules [BR:hsa04090]
 Proteins
  912 (CD1D)
SSDB
Motif
Pfam: MHC_I_3 C1-set MHC_I Kelch_2 Ig_3
Other DBs
NCBI-GeneID: 912
NCBI-ProteinID: NP_001757
OMIM: 188410
HGNC: 1637
Ensembl: ENSG00000158473
Vega: OTTHUMG00000022436
Pharos: P15813(Tbio)
UniProt: P15813
Structure
PDB: 

Position
1q23.1
AA seq 335 aa
MGCLLFLLLWALLQAWGSAEVPQRLFPLRCLQISSFANSSWTRTDGLAWLGELQTHSWSN
DSDTVRSLKPWSQGTFSDQQWETLQHIFRVYRSSFTRDVKEFAKMLRLSYPLELQVSAGC
EVHPGNASNNFFHVAFQGKDILSFQGTSWEPTQEAPLWVNLAIQVLNQDKWTRETVQWLL
NGTCPQFVSGLLESGKSELKKQVKPKAWLSRGPSPGPGRLLLVCHVSGFYPKPVWVKWMR
GEQEQQGTQPGDILPNADETWYLRATLDVVAGEAAGLSCRVKHSSLEGQDIVLYWGGSYT
SMGLIALAVLACLLFLLIVGFTSRFKRQTSYQGVL
NT seq 1008 nt   +upstreamnt  +downstreamnt
atggggtgcctgctgtttctgctgctctgggcgctcctccaggcttggggaagcgctgaa
gtcccgcaaaggcttttccccctccgctgcctccagatctcgtccttcgccaatagcagc
tggacgcgcaccgacggcttggcgtggctgggggagctgcagacgcacagctggagcaac
gactcggacaccgtccgctctctgaagccttggtcccagggcacgttcagcgaccagcag
tgggagacgctgcagcatatatttcgggtttatcgaagcagcttcaccagggacgtgaag
gaattcgccaaaatgctacgcttatcctatcccttggagctccaggtgtccgctggctgt
gaggtgcaccctgggaacgcctcaaataacttcttccatgtagcatttcaaggaaaagat
atcctgagtttccaaggaacttcttgggagccaacccaagaggccccactttgggtaaac
ttggccattcaagtgctcaaccaggacaagtggacgagggaaacagtgcagtggctcctt
aatggcacctgcccccaatttgtcagtggcctccttgagtcagggaagtcggaactgaag
aagcaagtgaagcccaaggcctggctgtcccgtggccccagtcctggccctggccgtctg
ctgctggtgtgccatgtctcaggattctacccaaagcctgtatgggtgaagtggatgcgg
ggtgagcaggagcagcagggcactcagccaggggacatcctgcccaatgctgacgagaca
tggtatctccgagcaaccctggatgtggtggctggggaggcagctggcctgtcctgtcgg
gtgaagcacagcagtctagagggccaggacatcgtcctctactggggtgggagctacacc
tccatgggcttgattgccttggcagtcctggcgtgcttgctgttcctcctcattgtgggc
tttacctcccggtttaagaggcaaacttcctatcagggcgtcctgtga

DBGET integrated database retrieval system