KEGG   Homo sapiens (human): 91227
Entry
91227             CDS       T01001                                 

Gene name
GGTLC2, GGTL4
Definition
(RefSeq) gamma-glutamyltransferase light chain 2
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: G_glu_transpept
Other DBs
NCBI-GeneID: 91227
NCBI-ProteinID: NP_954578
OMIM: 612339
HGNC: 18596
Ensembl: ENSG00000100121
Vega: OTTHUMG00000151177
Pharos: Q14390(Tdark)
UniProt: Q14390
Position
22q11.22
AA seq 218 aa
MTSEFFAAQLRAQISDDTTHPISYYKPEFYTPVDGGTAHLSVVAEDGSAVSATSTINLYF
GSKVRSPVSEILFNDEMDDFSSPNITNEFGVPPSPANFIQPGKQPLSSMCPTIMVGQDGQ
PPSHADHTPMPQAIIYNLWFGYDVKRAVEEPRLHNQLLPNVTTVERNIDQAVTAALETRH
HHTQIASTFIAVVQAIVRTAGGWAAASDSRKGGEPAGY
NT seq 657 nt   +upstreamnt  +downstreamnt
atgacctctgagttcttcgctgcccagctccgggcccagatctctgacgacaccactcac
ccgatctcctactacaagcccgagttctacacgccggttgatgggggcactgctcacctg
tctgtcgtcgcagaggacggcagtgctgtgtccgccaccagcaccatcaacctctacttt
ggctccaaggtccgctccccggtcagcgagatcctgttcaatgatgaaatggatgacttc
agctctcccaacatcaccaacgagtttggggtgcccccctcacctgccaatttcatccag
ccagggaagcagccgctctcgtcaatgtgcccgacgatcatggtgggccaggacggccag
cccccaagccatgctgatcacactcccatgccccaggccatcatctacaacctctggttc
ggctatgacgtgaagcgggccgtggaggagccccggctgcacaaccagcttctgcccaac
gtcacgacagtggagagaaacattgaccaggcagtgactgcagccctggagacccggcac
catcacacccagatcgcgtccaccttcatcgctgtggtgcaagccatcgtccgcacggct
ggtggctgggcagctgcctcggactccaggaaaggcggggagcctgccggctactga

DBGET integrated database retrieval system