KEGG   Homo sapiens (human): 91289Help
Entry
91289             CDS       T01001                                 

Gene name
LMF2, TMEM112B, TMEM153
Definition
(RefSeq) lipase maturation factor 2
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: LMF1
Motif
Other DBs
NCBI-GeneID: 91289
NCBI-ProteinID: NP_149977
HGNC: 25096
Ensembl: ENSG00000100258
Vega: OTTHUMG00000150206
Pharos: Q9BU23(Tdark)
UniProt: Q9BU23
Position
22q13.33
AA seq 707 aa AA seqDB search
MAGSRLPRQLFLQGVAAVFMFAFASLYTQIPGLYGPEGILPARRTLRPQGKGRWQQLWET
PTLLWEAPRLGLDTAQGLELLSLLGALVALGALLLSPLRHPVIYLLLWAAYLSACQVGQV
FLYFQWDSLLLETGFLAVLVAPLRPASHRKEAPQGRQAGALPHEDLPFWLVRWLLFRLMF
ASGVVKLTSRCPAWWGLTALTYHYETQCLPTPAAWFAHHLPVWLHKLSVVATFLIEIAVP
PLFFAPIRRLRLAAFYSQVLLQVLIIITGNYNFFNLMTLVLTTALLDDQHLAAEPGHGSR
KKTATSWPKALLATLSLLLELAVYGLLAYGTVHYFGLEVDWQQRTIHSRTTFTFHQFSQW
LKTLTLPTVWLGVASLVWELLSALWRWTQVRGWLRKLSAVVQLSLVGTATVALFLISLVP
YSYVEPGTHGRLWTGAHRLFGAVEHLQLANSYGLFRRMTGLGGRPEVVLEGSYDGHHWTE
IEFMYKPGNLSRPPPVVVPHQPRLDWQMWFAALGPHTHSPWFTSLVLRLLQGKEPVIRLV
QSQVARYPFHKQPPTYVRAQRYKYWFSQPGEQGQWWRRQWVEEFFPSVSLGDPTLETLLR
QFGLQEKSPPRTRSANSTLAQALHWTRSQLSPLEAPALLWGLLMAVGAVRFVQALLAPCS
LRSSPLAPVSGEKRRPASQKDSGAASEQATAAPNPCSSSSRTTRRKK
NT seq 2124 nt NT seq  +upstreamnt  +downstreamnt
atggcgggctcccggctcccgcggcagctcttcctccagggcgtggcggccgtcttcatg
tttgctttcgcttccctctacacgcaaatcccaggcctgtatggccccgagggcatccta
cctgcaaggaggacgctgcggcctcagggcaaggggcgctggcagcagctgtgggagacc
ccgacgctgctgtgggaagcgccgagactggggctggacacggcccagggcctggagctg
ctgagcctgctgggtgcactagtggccctgggagccctgctgctgagcccactgcgccac
cctgtcatctacttgctgctttgggccgcctacctgtcagcctgccaggtgggccaggtg
ttcctttatttccagtgggactccctgctgctagagactggcttcctggccgtgctggtg
gccccgctgaggccagcctcccaccgcaaggaggccccccagggcaggcaggcaggggcc
ctgccccacgaagacctccccttctggctggtgcgatggctgctgttccgcctcatgttc
gcctcaggcgtggtcaagctgaccagccgctgccctgcgtggtgggggctcactgccctc
acctaccactacgagacccagtgcctgcccacgcccgccgcctggttcgcacaccacctg
ccggtctggctgcacaagctcagcgtggtggccaccttcctaattgagatcgctgtgccg
cccctgttcttcgcccccattcgacgcctgcgcttggctgctttctactcgcaggtgctg
ctgcaggtcctgattatcatcaccggcaactacaacttcttcaacctgatgacgctggtg
cttaccactgcgctgctggacgaccagcacctggctgctgagcctggccacggcagccgc
aagaagacggccacctcctggcccaaggccctgctggccaccctgtcgctgctgctggaa
ctagccgtctacgggcttctggcctatggcactgtgcactactttggcctggaggttgac
tggcagcagcgcaccatccactccagaaccactttcaccttccaccagttttctcagtgg
ctgaagacactgacgctgcccactgtgtggctgggtgtggcctccctggtctgggagctg
ctgagtgccctgtggaggtggacccaggtgcggggctggctacggaagctcagtgctgta
gtccaactgtcccttgtgggcactgcgaccgtggccttgttcctgattagcctggtgccg
tactcctacgtggagcccgggacccacgggcgcctctggaccggggcccaccgcctgttt
ggtgccgtggagcacctacagctggccaactcctacggcctcttccgccgcatgactggg
cttggtggacggcctgaggtggtgctggagggcagttacgacggccaccactggacggag
atcgagttcatgtacaagcctgggaacctgagccggccgcccccggttgtggtgccccac
cagccacgcctggactggcagatgtggtttgcagccctgggcccacacacgcacagcccg
tggttcacaagcctggtcttgcgcctgctgcagggcaaggagccagtgatccgccttgtc
cagagccaagtggccaggtatcccttccacaagcagccgcccacctacgtccgagcccag
cgctacaagtactggttctcccagcctggggagcagggccagtggtggcggcgccagtgg
gtggaggagttcttcccatccgtgtccctgggggaccccacgctggagacgctgctcagg
cagtttggactacaggagaaaagcccacctcgcacccgcagcgccaacagcaccctggcc
caggccctccactggactcgctctcagctgtctcccctggaggcccccgccctgctctgg
gggctcctcatggccgtgggggctgtcagatttgtgcaagccctgctagcaccctgttct
ctccggtcctccccgctggcaccagtcagcggggagaagcgcaggccagcctcccagaaa
gactccggagctgcctccgaacaggccaccgcagcccccaacccctgctccagtagttcg
aggaccacccggcgaaagaagtag

DBGET integrated database retrieval system