KEGG   Homo sapiens (human): 9129
Entry
9129              CDS       T01001                                 

Gene name
PRPF3, HPRP3, HPRP3P, PRP3, Prp3p, RP18, SNRNP90
Definition
(RefSeq) pre-mRNA processing factor 3
  KO
K12843  U4/U6 small nuclear ribonucleoprotein PRP3
Organism
hsa  Homo sapiens (human)
Pathway
hsa03040  Spliceosome
Disease
H00527  Retinitis pigmentosa
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    9129 (PRPF3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:hsa03041]
    9129 (PRPF3)
Spliceosome [BR:hsa03041]
 Complex B
  U4/U6.U5 tri-snRNP components
   U4/U6 snRNP specific factors
    9129 (PRPF3)
SSDB
Motif
Pfam: PRP3 DUF1115 PWI
Other DBs
NCBI-GeneID: 9129
NCBI-ProteinID: NP_004689
OMIM: 607301
HGNC: 17348
Ensembl: ENSG00000117360
Vega: OTTHUMG00000012807
Pharos: O43395(Tbio)
UniProt: O43395
Structure
PDB: 
5O9Z 6AH0 3JCR 1X4Q

Position
1q21.2
AA seq 683 aa
MALSKRELDELKPWIEKTVKRVLGFSEPTVVTAALNCVGKGMDKKKAADHLKPFLDDSTL
RFVDKLFEAVEEGRSSRHSKSSSDRSRKRELKEVFGDDSEISKESSGVKKRRIPRFEEVE
EEPEVIPGPPSESPGMLTKLQIKQMMEAATRQIEERKKQLSFISPPTPQPKTPSSSQPER
LPIGNTIQPSQAATFMNDAIEKARKAAELQARIQAQLALKPGLIGNANMVGLANLHAMGI
APPKVELKDQTKPTPLILDEQGRTVDATGKEIELTHRMPTLKANIRAVKREQFKQQLKEK
PSEDMESNTFFDPRVSIAPSQRQRRTFKFHDKGKFEKIAQRLRTKAQLEKLQAEISQAAR
KTGIHTSTRLALIAPKKELKEGDIPEIEWWDSYIIPNGFDLTEENPKREDYFGITNLVEH
PAQLNPPVDNDTPVTLGVYLTKKEQKKLRRQTRREAQKELQEKVRLGLMPPPEPKVRISN
LMRVLGTEAVQDPTKVEAHVRAQMAKRQKAHEEANAARKLTAEQRKVKKIKKLKEDISQG
VHISVYRVRNLSNPAKKFKIEANAGQLYLTGVVVLHKDVNVVVVEGGPKAQKKFKRLMLH
RIKWDEQTSNTKGDDDEESDEEAVKKTNKCVLVWEGTAKDRSFGEMKFKQCPTENMAREH
FKKHGAEHYWDLALSESVLESTD
NT seq 2052 nt   +upstreamnt  +downstreamnt
atggcactgtcaaagagggagctggatgagctgaaaccatggatagagaagacagtgaag
agggtcctgggtttctcagagcctacggtggtcacagcagcattgaactgtgtggggaag
ggcatggacaagaagaaggcagccgatcatctgaaaccttttcttgatgattctactctc
cgatttgtggacaaactgtttgaggctgtggaggaaggccgaagctctaggcattccaag
tctagcagtgacaggagcagaaaacgagagctaaaggaggtgtttggtgatgactctgag
atctctaaagaatcatcaggagtaaagaagcgacgaataccccgttttgaggaggtggaa
gaagagccagaggtgatccctgggcctccatcagagagccctggcatgctgactaagctc
cagatcaaacagatgatggaggcagcaacacgacaaatcgaggagaggaaaaaacagctg
agcttcattagcccccctacacctcagccaaagactccttcttcctcccaaccagaacga
cttcctattggcaacactattcagccctcccaggctgccactttcatgaatgatgccatt
gagaaggcaaggaaagcagctgaactgcaagctcgaatccaagcccagctggcactgaag
ccaggactcatcggcaatgccaacatggtgggcctggctaatctccatgccatgggcatt
gctcccccgaaggtggagttaaaagaccaaacgaaacctacaccactgatcctggatgag
caagggcgcactgtagatgcaacaggcaaggagattgagctgacacaccgcatgcctact
ctgaaagccaatattcgtgctgtgaagagggaacaattcaagcaacaactaaaggaaaag
ccatcagaagacatggaatccaataccttttttgacccccgagtctccattgccccttcc
cagcgccagagacgcacttttaaattccatgacaagggcaaatttgagaagattgctcag
cgattacggacaaaggctcaactggagaagctacaggcagagatttcacaagcagctcga
aaaacaggcatccatacttcgactaggcttgccctcattgctcctaagaaggagctaaag
gaaggagatattcctgaaattgagtggtgggactcttacataatccccaatggctttgat
cttacagaggaaaatcccaagagagaagattattttggaatcacaaatcttgttgaacat
ccagcccagctcaatcctccagttgacaatgacacaccagttactctgggagtatatctt
accaagaaggaacagaaaaaacttcggagacaaacaaggagggaagcacagaaggaacta
caagaaaaagtcaggctgggcctgatgcctcctccagaacccaaagtgagaatttctaat
ttgatgcgagtattaggaacagaagctgttcaagaccccacgaaggtagaagcccacgtc
agagctcagatggcaaaaagacagaaagcgcatgaagaggccaacgctgcccgaaaactc
acagcagaacagagaaaggtcaagaaaattaaaaagcttaaagaagacatttcacagggg
gtacacatatctgtatatagagttcgaaatttgagcaacccagccaagaagttcaagatt
gaagccaatgctgggcaactgtacctgacaggggtggtggtactgcacaaggatgtcaac
gtggtagtagtggaagggggccccaaggcccagaagaaatttaagcgtcttatgctgcat
cggataaagtgggatgaacagacatctaacacaaagggagatgatgatgaggagtctgat
gaggaagctgtgaagaaaaccaacaaatgtgtactagtctgggagggtacagccaaagac
cggagctttggagagatgaagtttaaacagtgtcctacagagaacatggctcgtgagcat
ttcaaaaagcatggggctgaacactactgggaccttgcgctgagtgaatctgtgttagag
tccactgattga

DBGET integrated database retrieval system