KEGG   Homo sapiens (human): 91298
Entry
91298             CDS       T01001                                 
Symbol
C12orf29
Name
(RefSeq) chromosome 12 open reading frame 29
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: DUF5565
Other DBs
NCBI-GeneID: 91298
NCBI-ProteinID: NP_001009894
HGNC: 25322
Ensembl: ENSG00000133641
Pharos: Q8N999(Tdark)
UniProt: Q8N999
Position
12:88035536..88050160
AA seq 325 aa
MKRLGSVQRKMPCVFVTEVKEEPSSKREHQPFKVLATETVSHKALDADIYSAIPTEKVDG
TCCYVTTYKDQPYLWARLDRKPNKQAEKRFKNFLHSKENPKEFFWNVEEDFKPAPECWIP
AKETEQINGNPVPDENGHIPGWVPVEKNNKQYCWHSSVVNYEFEIALVLKHHPDDSGLLE
ISAVPLSDLLEQTLELIGTNINGNPYGLGSKKHPLHLLIPHGAFQIRNLPSLKHNDLVSW
FEDCKEGKIEGIVWHCSDGCLIKVHRHHLGLCWPIPDTYMNSRPVIINMNLNKCDSAFDI
KCLFNHFLKIDNQKFVRLKDIIFDV
NT seq 978 nt   +upstreamnt  +downstreamnt
atgaagcgcttgggctccgtgcagcggaaaatgccgtgtgtgtttgtgacggaggtgaaa
gaggagccttcctccaaaagggagcatcagccatttaaagttttggcaactgaaactgta
agtcacaaggcattagatgcagatatatacagtgcaattccaacagaaaaagtggatgga
acatgttgttatgttactacctataaagatcagccatacctttgggctcgactagataga
aaacccaacaaacaagctgaaaaaagatttaaaaattttctacattcaaaagaaaaccca
aaagaatttttttggaacgttgaggaggacttcaaaccagctccggagtgctggatacca
gcaaaggagacagaacaaataaatgggaacccagtgcctgatgaaaatggacacattcct
ggttgggtaccagtagagaaaaacaacaaacagtattgctggcattcctctgtagttaat
tatgaatttgaaattgccctggtactaaaacatcatcctgatgattctggacttttggaa
attagtgcagtgccactttcagatctcttagaacaaacactggaactcataggaacaaat
atcaatggaaacccatatgggttagggagcaagaaacatccattacatcttcttatacca
catggagcatttcaaataagaaatctaccttcattgaagcacaatgatctcgtgtcctgg
tttgaagattgcaaagagggtaaaattgaaggaatagtgtggcattgcagtgatggctgt
ttaataaaggtccatcgccatcatcttggcttatgctggccaattccagatacttacatg
aattcaagaccagttattatcaacatgaacctgaacaaatgtgactctgcctttgatatt
aagtgtttgtttaatcattttttaaaaatagataatcagaaatttgttagactcaaagat
ataatatttgatgtataa

DBGET integrated database retrieval system