KEGG   Homo sapiens (human): 91319
Entry
91319             CDS       T01001                                 

Gene name
DERL3, C22orf14, IZP6, LLN2, derlin-3
Definition
(RefSeq) derlin 3
  KO
K13989  Derlin-2/3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    91319 (DERL3)
SSDB
Motif
Pfam: DER1 Oleosin
Other DBs
NCBI-GeneID: 91319
NCBI-ProteinID: NP_001002862
OMIM: 610305
HGNC: 14236
Ensembl: ENSG00000099958
Vega: OTTHUMG00000150743
Pharos: Q96Q80(Tbio)
UniProt: Q96Q80
Position
22q11.23
AA seq 235 aa
MAWQGLAAEFLQVPAVTRAYTAACVLTTAAVQLELLSPFQLYFNPHLVFRKFQVWRLVTN
FLFFGPLGFSFFFNMLFVFRYCRMLEEGSFRGRTADFVFMFLFGGVLMTLLGLLGSLFFL
GQALMAMLVYVWSRRSPRVRVNFFGLLTFQAPFLPWALMGFSLLLGNSILVDLLGIAVGH
IYYFLEDVFPNQPGGKRLLQTPGFLKLLLDAPAEDPNYLPLPEEQPGPHLPPPQQ
NT seq 708 nt   +upstreamnt  +downstreamnt
atggcgtggcagggactagcggccgagttcctgcaggtgccggcggtgacgcgggcttac
accgcagcctgtgtcctcaccaccgccgcggtgcagctggagctcctcagcccctttcaa
ctctacttcaacccgcaccttgtgttccggaagttccaggtctggaggctcgtcaccaac
ttcctcttcttcgggcccctgggattcagcttcttcttcaacatgctcttcgtgttccgc
tactgccgcatgctggaagagggctccttccgcggccgcacggccgacttcgtcttcatg
tttctcttcgggggcgtccttatgaccctgctgggactcctgggcagcctgttcttcctg
ggccaggccctcatggccatgctggtgtacgtgtggagccgccgcagccctcgggtgagg
gtcaacttcttcggcctgctcactttccaggcaccgttcctgccttgggcgctcatgggc
ttctcgctgctgctgggcaactccatcctcgtggacctgctggggattgcggtgggccat
atctactacttcctggaggacgtcttccccaaccagcctggaggcaagaggctcctgcag
acccctggcttcctaaagctgctcctggatgcccctgcagaagaccccaattacctgccc
ctccctgaggaacagccaggaccccatctgccacccccgcagcagtga

DBGET integrated database retrieval system