KEGG   Homo sapiens (human): 91368
Entry
91368             CDS       T01001                                 
Symbol
CDKN2AIPNL, C2AIL
Name
(RefSeq) CDKN2A interacting protein N-terminal like
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: XTBD
Other DBs
NCBI-GeneID: 91368
NCBI-ProteinID: NP_542387
HGNC: 30545
Ensembl: ENSG00000237190
Pharos: Q96HQ2(Tdark)
UniProt: Q96HQ2
Position
5:complement(134402065..134411881)
AA seq 116 aa
MVGGEAAAAVEELVSGVRQAADFAEQFRSYSESEKQWKARMEFILRHLPDYRDPPDGSGR
LDQLLSLSMVWANHLFLGCSYNKDLLDKVMEMADGIEVEDLPQFTTRSELMKKHQS
NT seq 351 nt   +upstreamnt  +downstreamnt
atggtcggtggcgaggcggctgccgcagtggaggagctggtttcgggggtgcggcaggcg
gccgacttcgcggagcagttccgctcctactcagagagcgagaagcaatggaaggcccgc
atggaattcatcctgcgccacctgcccgactaccgcgacccgcccgacggcagtggccgc
ctggaccagctgctctccctctccatggtctgggccaaccatctcttcctaggctgcagt
tacaataaagaccttttagacaaggtgatggaaatggccgatgggattgaagtggaagac
ctgccacaatttactaccagaagtgaattaatgaaaaagcatcaaagctaa

DBGET integrated database retrieval system