KEGG   Homo sapiens (human): 91369
Entry
91369             CDS       T01001                                 
Symbol
ANKRD40
Name
(RefSeq) ankyrin repeat domain 40
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: Ank_4 Ank_2 Ank Ank_3 Ank_5
Other DBs
NCBI-GeneID: 91369
NCBI-ProteinID: NP_443087
HGNC: 28233
Ensembl: ENSG00000154945
Pharos: Q6AI12(Tdark)
UniProt: Q6AI12 A8IK34
Position
17:complement(50693198..50707914)
AA seq 368 aa
MNALLEQKEQQERLREAAALGDIREVQKLVESGVDVNSQNEVNGWTCLHWACKRNHGQVV
SYLLKSGADKEILTTKGEMPVQLTSRREIRKIMGVEEEDDDDDDDDNLPQLKKESELPFV
PNYLANPAFPFIYTPTAEDSAQMQNGGPSTPPASPPADGSPPLLPPGEPPLLGTFPRDHT
SLALVQNGDVSAPSAILRTPESTKPGPVCQPPVSQSRSLFSSVPSKPPMSLEPQNGTYAG
PAPAFQPFFFTGAFPFNMQELVLKVRIQNPSLRENDFIEIELDRQELTYQELLRVCCCEL
GVNPDQVEKIRKLPNTLLRKDKDVARLQDFQELELVLMISENNFLFRNAASTLTERPCYN
RRASKLTY
NT seq 1107 nt   +upstreamnt  +downstreamnt
atgaacgccctcctagagcagaaggagcagcaggagaggctgcgggaggccgcggcctta
ggggacattcgggaggtgcagaaactggtggagagcggggtggatgtgaactcccaaaat
gaggtcaacggctggacttgtttacactgggcatgtaaacgaaaccatggtcaggtggtc
tcttacctgttaaaatcaggagctgacaaagaaattcttaccacaaaaggagaaatgcca
gtccagttaacatcaaggagagaaatcaggaagattatgggagtggaagaagaagatgat
gatgatgatgatgatgacaacctcccccagctgaagaaggagtcagaactgccctttgtt
cccaactatttggccaacccagccttcccttttatctatacacccacagcagaggattca
gcccagatgcagaatgggggcccctccacaccccctgcatcaccccctgcagatggctca
cctccattgcttccccctggggaacctcccctgttagggacctttccccgggaccacacc
tctttggcactagttcagaatggtgatgtgtcggccccctctgccatactcagaacacca
gaaagcacaaaaccgggtcctgtttgtcagccaccagtgagtcagagccgctccctgttt
tcttctgtcccgtccaagccaccaatgtctctggagcctcaaaatgggacgtatgcagga
ccagcgccagcattccagccatttttcttcactggagcatttccatttaatatgcaagag
ctggtactcaaggtgagaattcagaacccatctcttcgagaaaatgatttcattgaaatt
gaactggaccgacaggagctcacctaccaagagttgctcagagtgtgttgctgtgagctg
ggtgttaatccagatcaagtggagaagatcagaaagttacccaatactctgttaaggaag
gacaaggatgttgctcgactccaagatttccaggagctggaactggttctgatgataagt
gaaaataattttctgttcagaaatgctgcatccacactgactgaaaggccttgctataac
aggagagcttcaaaactgacttactaa

DBGET integrated database retrieval system