KEGG   Homo sapiens (human): 91373
Entry
91373             CDS       T01001                                 
Symbol
UAP1L1
Name
(RefSeq) UDP-N-acetylglucosamine pyrophosphorylase 1 like 1
  KO
K00972  UDP-N-acetylglucosamine/UDP-N-acetylgalactosamine diphosphorylase [EC:2.7.7.23 2.7.7.83]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00520  Amino sugar and nucleotide sugar metabolism
hsa01100  Metabolic pathways
hsa01250  Biosynthesis of nucleotide sugars
Module
hsa_M00892  UDP-N-acetyl-D-glucosamine biosynthesis, eukaryotes, glucose => UDP-GlcNAc
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    91373 (UAP1L1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.23  UDP-N-acetylglucosamine diphosphorylase
     91373 (UAP1L1)
    2.7.7.83  UDP-N-acetylgalactosamine diphosphorylase
     91373 (UAP1L1)
SSDB
Motif
Pfam: UDPGP NTP_transf_3
Other DBs
NCBI-GeneID: 91373
NCBI-ProteinID: NP_997192
HGNC: 28082
Ensembl: ENSG00000197355
Pharos: Q3KQV9(Tdark)
UniProt: Q3KQV9
Position
9:137077517..137084538
AA seq 507 aa
MASEQDVRARLQRAGQEHLLRFWAELAPEPRAALLAELALLEPEALREHCRRAAEACARP
HGPPPDLAARLRPLPPERVGRASRSDPETRRRWEEEGFRQISLNKVAVLLLAGGQGTRLG
VTYPKGMYRVGLPSRKTLYQLQAERIRRVEQLAGERHGTRCTVPWYVMTSEFTLGPTAEF
FREHNFFHLDPANVVMFEQRLLPAVTFDGKVILERKDKVAMAPDGNGGLYCALEDHKILE
DMERRGVEFVHVYCVDNILVRLADPVFIGFCVLQGADCGAKVVEKAYPEEPVGVVCQVDG
VPQVVEYSEISPETAQLRASDGSLLYNAGNICNHFFTRGFLKAVTREFEPLLKPHVAVKK
VPYVDEEGNLVKPLKPNGIKMEKFVFDVFRFAKNFAALEVLREEEFSPLKNAEPADRDSP
RTARQALLTQHYRWALRAGARFLDAHGAWLPELPSLPPNGDPPAICEISPLVSYSGEGLE
VYLQGREFQSPLILDEDQAREPQLQES
NT seq 1524 nt   +upstreamnt  +downstreamnt
atggcttcggagcaggacgtgcgcgcccggctgcagcgcgctggccaggagcacctcctg
cgcttctgggccgagctggcgccggagccacgagccgcgctgctggcggagctggcgctg
ctggagcccgaggcgctgcgcgagcactgccggcgggcggcggaggcctgcgcgcgcccc
cacggcccgccgcccgacttggccgcgcgcctgcggcccctgcccccagagcgcgtgggc
agggccagccgcagcgaccccgagacacggcggcgctgggaggaggaaggtttccgtcag
atttctctgaacaaggtggccgtcctgctgctggctggggggcagggcactcgcctgggc
gtgacctaccccaagggtatgtaccgtgtggggctgcccagccggaagaccctgtaccag
ctgcaggcggagcggattcggcgggtggagcagctggccggtgagcgccacgggacccgc
tgcaccgtcccctggtacgtcatgaccagcgagttcactctggggcccacggccgagttc
ttcagggagcacaacttcttccacctggaccccgccaacgtggtcatgtttgagcagcgc
ctgctgcctgctgtgacctttgatggcaaggttatcctggagcggaaagacaaagttgcc
atggccccagacggcaacgggggcctctactgcgcgctggaggaccacaagatcctggag
gacatggagcgccggggagtggagtttgtgcacgtgtactgtgtggacaacatcctggtg
cggctggcggaccctgtcttcatcggcttctgtgtgttgcagggcgcagactgtggcgcc
aaggtggtggaaaaggcataccccgaggagcccgtgggcgtggtgtgccaggtggacggt
gtcccccaggtggtggagtacagcgagatcagtcctgagaccgcacagctacgtgcctcc
gacgggagcctgctgtacaatgcaggcaacatctgcaaccacttcttcacccgaggcttc
cttaaggcggtcaccagggagtttgagcctttgctgaagccacacgtggctgtgaagaag
gtcccgtatgtggatgaggaggggaatctggtaaagccgctaaaaccgaacgggataaag
atggagaagtttgtgtttgatgtgttccggtttgctaagaactttgctgccttggaagtg
ctgcgggaggaggaattttccccactgaagaacgcagagccagccgacagggacagtccc
cgcaccgctcgccaggccctgctcacccagcactaccggtgggctctgcgggccggggcc
cgcttcctggatgcccatggggcctggctcccagagctgcccagcttgcccccaaatgga
gaccctccggccatctgtgagatatcgcccttggtgtcttactctggagagggtttagaa
gtgtacctgcaaggccgggagttccagtccccgctcatcctggatgaagaccaggccagg
gagccgcagctgcaggagtcctga

DBGET integrated database retrieval system