KEGG   Homo sapiens (human): 9139
Entry
9139              CDS       T01001                                 
Symbol
CBFA2T2, EHT, MTGR1, ZMYND3, p85
Name
(RefSeq) CBFA2/RUNX1 partner transcriptional co-repressor 2
  KO
K22751  CBFA2/RUNX1 translocation partner 2
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:hsa04990]
    9139 (CBFA2T2)
Domain-containing proteins not elsewhere classified [BR:hsa04990]
 Zinc finger domain-containing proteins
  MYND-type zinc finger domain-containing proteins
   9139 (CBFA2T2)
SSDB
Motif
Pfam: TAFH NHR2 zf-MYND BBS1
Other DBs
NCBI-GeneID: 9139
NCBI-ProteinID: NP_005084
OMIM: 603672
HGNC: 1536
Ensembl: ENSG00000078699
Pharos: O43439(Tbio)
UniProt: O43439
Position
20:33490096..33650030
AA seq 604 aa
MAKESGISLKEIQVLARQWKVGPEKRVPAMPGSPVEVKIQSRSSPPTMPPLPPINPGGPR
PVSFTPTALSNGINHSPPTLNGAPSPPQRFSNGPASSTSSALTNQQLPATCGARQLSKLK
RFLTTLQQFGNDISPEIGEKVRTLVLALVNSTVTIEEFHCKLQEATNFPLRPFVIPFLKA
NLPLLQRELLHCARAAKQTPSQYLAQHEHLLLNTSIASPADSSELLMEVHGNGKRPSPER
REENSFDRDTIAPEPPAKRVCTISPAPRHSPALTVPLMNPGGQFHPTPPPLQHYTLEDIA
TSHLYREPNKMLEHREVRDRHHSLGLNGGYQDELVDHRLTEREWADEWKHLDHALNCIME
MVEKTRRSMAVLRRCQESDREELNYWKRRYNENTELRKTGTELVSRQHSPGSADSLSNDS
QREFNSRPGTGYVPVEFWKKTEEAVNKVKIQAMSEVQKAVAEAEQKAFEVIATERARMEQ
TIADVKRQAAEDAFLVINEQEESTENCWNCGRKASETCSGCNIARYCGSFCQHKDWERHH
RLCGQNLHGQSPHGQGRPLLPVGRGSSARSADCSVPSPALDKTSATTSRSSTPASVTAID
TNGL
NT seq 1815 nt   +upstreamnt  +downstreamnt
atggctaaagaatctggaataagcttgaaagaaatacaggtcctggcaaggcaatggaaa
gttggtcctgagaaaagggtgccagcgatgcctggatcgcctgtggaagtgaagatacag
tccagatcctcacctcccaccatgccacccctcccaccaataaatcctggaggaccgagg
ccagtgtccttcactcctactgcattaagcaatggcatcaaccattctcctcctaccctg
aatggtgccccatcaccgccacagagattcagcaatggtcctgcctcctccacatcatct
gcactcacaaatcagcaattgccagccacttgtggtgctcgacaactcagcaagttgaaa
cgctttcttaccactctgcaacagtttggcaatgacatctcccctgagattggggagaag
gtgcggactcttgttcttgcactggtgaactcaacagtgacaattgaggaattccactgt
aagctccaagaagccacaaactttccccttcgtccttttgtgattccatttctcaaggcc
aacctgcccctgctgcagcgggaactgctgcactgcgctcgggcggccaagcagacccca
tcccagtacctggctcagcacgaacaccttctgctcaacacaagcattgcatcgcctgct
gactcgtcagagttgctcatggaggtgcacggaaatgggaagaggcccagtccagagagg
agagaagagaatagttttgatagagacacaattgctcctgagcctcctgccaagagagta
tgtaccatcagccctgctcctcggcacagtcctgctctcactgtgcccctcatgaatccc
gggggccaattccatcctacccctccacctcttcagcattacaccttagaggatattgca
acttctcacctgtatcgggaacccaacaagatgctagagcatcgagaagttcgtgataga
caccacagtcttggtctaaatggaggctatcaagatgagttggtagatcatcgtttgaca
gaaagggaatgggctgatgaatggaaacatcttgaccatgcgctgaattgcattatggaa
atggtagagaaaacaaggcgctctatggcagttctgcggcgctgtcaggaatcagatcgt
gaagaactcaactactggaaaagacggtacaatgaaaacacagagctgaggaaaacgggg
accgagttggtctccaggcagcacagccctgggagtgcagattctctcagcaatgattct
cagagagagttcaacagcaggccaggtacaggatacgtacctgtggagttttggaaaaaa
acagaagaagctgtgaataaggtgaaaattcaggccatgtcagaagtacagaaggccgtc
gctgaggcagagcagaaagcctttgaagtgattgcaacagagagagcacgaatggagcaa
accatagcggatgtcaagcggcaggccgcagaggatgctttcctcgtcatcaatgagcaa
gaggagtccacggagaactgctggaactgtggccgcaaagccagcgagacatgcagtggc
tgcaatatcgcgcgatactgtggctctttctgccagcacaaggactgggagcggcaccac
cgcctctgtggtcagaacctgcatggccagagcccccacggccagggccggccgctgctt
cctgtaggcaggggctcctctgccaggtccgccgactgcagcgtgcccagcccagccctc
gacaagacctcggcaaccacatcgcgttcctcaacacctgcttctgtgacagctatcgac
accaacggactctga

DBGET integrated database retrieval system