KEGG   Homo sapiens (human): 91433
Entry
91433             CDS       T01001                                 
Symbol
RCCD1
Name
(RefSeq) RCC1 domain containing 1
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: RCC1 RCC1_2 DUF6476
Other DBs
NCBI-GeneID: 91433
NCBI-ProteinID: NP_001017919
OMIM: 617997
HGNC: 30457
Ensembl: ENSG00000166965
Pharos: A6NED2(Tdark)
UniProt: A6NED2 A0A024RC72
Structure
Position
15:90954884..90963125
AA seq 376 aa
MAEERPGAWFGFGFCGFGQELGSGRGRQVHSPSPLRAGVDICRVSASWSYTAFVTRGGRL
ELSGSASGAAGRCKDAWASEGLLAVLRAGPGPEALLQVWAAESALRGEPLWAQNVVPEAE
GEDDPAGEAQAGRLPLLPCARAYVSPRAPFYRPLAPELRARQLELGAEHALLLDAAGQVF
SWGGGRHGQLGHGTLEAELEPRLLEALQGLVMAEVAAGGWHSVCVSETGDIYIWGWNESG
QLALPTRNLAEDGETVAREATELNEDGSQVKRTGGAEDGAPAPFIAVQPFPALLDLPMGS
DAVKASCGSRHTAVVTRTGELYTWGWGKYGQLGHEDTTSLDRPRRVEYFVDKQLQVKAVT
CGPWNTYVYAVEKGKS
NT seq 1131 nt   +upstreamnt  +downstreamnt
atggcggaggagcggccgggggcctggttcggcttcggtttctgcggcttcgggcaggag
ctgggctccggacgcgggcgccaggtgcacagccccagtccgctgcgggcgggcgtcgac
atctgccgcgtgagcgcgagctggagctacaccgctttcgtgacccgtggaggccgcttg
gagctgtcgggctcagccagcggcgcggcgggccgctgcaaggacgcgtgggcctcggag
gggctcctcgcggtgctgcgcgccgggccggggccggaggcgttactgcaggtctgggcg
gccgaatcggcgctgcgtggggagccattgtgggcccagaatgtggtgcccgaggccgaa
ggggaagacgatccggccggtgaggcccaggctgggaggctacccctgctgccctgcgcc
cgtgcctacgtgagcccgcgggcgcccttctaccggcctctggctccggagctgcgggca
cgccagctggagctgggcgccgagcacgcgttgctgctggacgctgctggccaggtgttc
tcctggggcgggggcaggcatggacagctgggccatgggaccctggaggcagagctggag
ccacggctgttggaggcgttgcagggcctagtcatggctgaggtggccgcggggggctgg
cattctgtgtgtgtgagtgagactggggatatttatatctggggctggaatgaatcaggg
cagctggccctgcccaccaggaacctggcagaggatggagagactgtcgcaagggaagcc
acagaactgaatgaagatggttctcaggtgaagagaacgggtggggctgaggatggagcc
cctgcccccttcatagctgtccagcccttcccggcattactggatctccccatgggctca
gatgcagtcaaggccagctgtggatcccggcacacagctgtggtgacacgaacaggggag
ctctacacctggggctggggtaaatatggacagctgggccacgaggacaccaccagcttg
gatcggcctcgccgtgtggaatactttgtagataagcaactccaagtaaaggctgtcacc
tgtgggccgtggaacacctacgtgtatgctgtggagaaagggaagagctga

DBGET integrated database retrieval system