KEGG   Homo sapiens (human): 91442
Entry
91442             CDS       T01001                                 

Gene name
FAAP24, C19orf40
Definition
(RefSeq) FA core complex associated protein 24
  KO
K10898  fanconi anemia-associated protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa03460  Fanconi anemia pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03460 Fanconi anemia pathway
    91442 (FAAP24)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:hsa03400]
    91442 (FAAP24)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   FA (Fanconi anemia) pathway
    FA core complex
     91442 (FAAP24)
SSDB
Motif
Pfam: PND HHH_2 Rad10 HHH_5 5_3_exonuc
Other DBs
NCBI-GeneID: 91442
NCBI-ProteinID: NP_689479
OMIM: 610884
HGNC: 28467
Ensembl: ENSG00000131944
Vega: OTTHUMG00000180339
Pharos: Q9BTP7(Tbio)
UniProt: Q9BTP7 A0A0S2Z5V6
Structure
PDB: 
4BXO 4M6W 2M9M 2M9N 2LYH

Position
19q13.11
AA seq 215 aa
MEKNPPDDTGPVHVPLGHIVANEKWRGSQLAQEMQGKIKLIFEDGLTPDFYLSNRCCILY
VTEADLVAGNGYRKRLVRVRNSNNLKGIVVVEKTRMSEQYFPALQKFTVLDLGMVLLPVA
SQMEASCLVIQLVQEQTKEPSKNPLLGKKRALLLSEPSLLRTVQQIPGVGKVKAPLLLQK
FPSIQQLSNASIGELEQVVGQAVAQQIHAFFTQPR
NT seq 648 nt   +upstreamnt  +downstreamnt
atggaaaagaacccccctgatgatacgggccccgtgcacgtgcctttggggcatattgtg
gccaatgagaaatggcgcgggtcacagctggcgcaggagatgcaagggaaaattaagctc
attttcgaggatggcttgacaccagacttttatctgtcgaacagatgctgcattctttat
gtcaccgaagctgatttggtggcaggaaatggctacagaaagaggcttgttcgggttaga
aattccaataatcttaaaggaattgtagtcgttgaaaaaacccggatgagtgaacaatac
ttcccagccctacagaagtttactgtgctggaccttggaatggtgctgcttccagtggcc
agccagatggaagcatcctgcctcgtcatccagttggttcaagagcaaaccaaagagccc
agtaagaaccctcttctcgggaagaaacgggccctgctgctgtctgagccttcgctcctt
cgaaccgtgcagcagatcccaggagttggaaaagttaaagctccccttctcctccagaag
tttccaagcatccagcaactgagtaatgcttccattggggaactggagcaggtggtcgga
caagcagtggcacagcagatccatgccttcttcacgcagcccaggtga

DBGET integrated database retrieval system