KEGG   Homo sapiens (human): 91464Help
Entry
91464             CDS       T01001                                 

Gene name
ISX, Pix-1, RAXLX
Definition
(RefSeq) intestine specific homeobox
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: Homeodomain Homeobox_KN
Motif
Other DBs
NCBI-GeneID: 91464
NCBI-ProteinID: NP_001290437
OMIM: 612019
HGNC: 28084
Ensembl: ENSG00000175329
Vega: OTTHUMG00000150962
Pharos: Q2M1V0(Tdark)
UniProt: Q2M1V0
Position
22q12.3
AA seq 245 aa AA seqDB search
MCAEVGPALCRGMERNSLGCCEAPKKLSLSFSIEAILKRPARRSDMDRPEGPGEEGPGEA
AASGSGLEKPPKDQPQEGRKSKRRVRTTFTTEQLHELEKIFHFTHYPDVHIRSQLAARIN
LPEARVQIWFQNQRAKWRKQEKIGNLGAPQQLSEASVALPTNLDVAGPTWTSTALRRLAP
PTSCCPSAQDQLASAWFPAWITLLPAHPWETQPVPGLPIHQTCIPVLCILPPPHPKWGSI
CATST
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atgtgtgctgaggtgggccctgctctctgcaggggtatggagagaaatagcttggggtgc
tgtgaggccccgaagaagctgagcctgtccttctccattgaggcgatcctaaagaggcct
gccaggaggagtgatatggacagaccagaagggccaggtgaagagggccccggagaagct
gcggcctcaggctctgggctagaaaagcctccaaaggaccagccccaggaaggaaggaag
agcaagcggagggttcgtaccaccttcaccactgagcagctgcatgagctggagaagatc
ttccactttacccactacccagacgttcacatccgcagccagctggcagccaggatcaac
ctcccagaagctcgggtgcagatctggttccagaatcagcgagccaagtggcggaagcag
gagaagattggcaacctgggggctccacagcagctgagtgaagccagtgtggccctgccc
acaaatctggatgtggctgggcccacgtggacatccactgctctgcgcaggctggctcct
cccacgagctgttgtccatcggctcaagatcagctggcctctgcctggttccctgcctgg
atcaccctcctcccagcgcacccatgggaaacacagcctgtcccaggtcttcccatccat
caaacttgcatccctgtgctatgcatccttccacctccacaccccaaatggggcagcatc
tgtgctacttcaacatag

DBGET integrated database retrieval system