KEGG   Homo sapiens (human): 915Help
Entry
915               CDS       T01001                                 

Gene name
CD3D, CD3-DELTA, IMD19, T3D
Definition
(RefSeq) CD3d molecule
  KO
K06450  T-cell surface glycoprotein CD3 delta chain
Organism
hsa  Homo sapiens (human)
Pathway
hsa04640  Hematopoietic cell lineage
hsa04658  Th1 and Th2 cell differentiation
hsa04659  Th17 cell differentiation
hsa04660  T cell receptor signaling pathway
hsa05142  Chagas disease (American trypanosomiasis)
hsa05162  Measles
hsa05166  Human T-cell leukemia virus 1 infection
hsa05169  Epstein-Barr virus infection
hsa05170  Human immunodeficiency virus 1 infection
hsa05340  Primary immunodeficiency
Disease
H00091  T-B+Severe combined immunodeficiency
Drug target
Antithymocyte immunoglobulin (rabbit): D09190
Blinatumomab: D09325
Catumaxomab: D09207
Flotetuzumab: D11306
Muromonab-CD3: D05092
Otelixizumab: D08959
Teplizumab: D09013
Visilizumab: D06314
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    915 (CD3D)
   04660 T cell receptor signaling pathway
    915 (CD3D)
   04658 Th1 and Th2 cell differentiation
    915 (CD3D)
   04659 Th17 cell differentiation
    915 (CD3D)
 09160 Human Diseases
  09163 Immune diseases
   05340 Primary immunodeficiency
    915 (CD3D)
  09172 Infectious diseases: Viral
   05166 Human T-cell leukemia virus 1 infection
    915 (CD3D)
   05170 Human immunodeficiency virus 1 infection
    915 (CD3D)
   05162 Measles
    915 (CD3D)
   05169 Epstein-Barr virus infection
    915 (CD3D)
  09174 Infectious diseases: Parasitic
   05142 Chagas disease (American trypanosomiasis)
    915 (CD3D)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:hsa04090]
    915 (CD3D)
CD molecules [BR:hsa04090]
 Proteins
  915 (CD3D)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ig_4 ITAM Ig_5 DAP10
Motif
Other DBs
NCBI-GeneID: 915
NCBI-ProteinID: NP_000723
OMIM: 186790
HGNC: 1673
Ensembl: ENSG00000167286
Vega: OTTHUMG00000166970
Pharos: P04234(Tclin)
UniProt: P04234 B0YIY4
Structure
PDB: 

Position
11q23.3
AA seq 171 aa AA seqDB search
MEHSTFLSGLVLATLLSQVSPFKIPIEELEDRVFVNCNTSITWVEGTVGTLLSDITRLDL
GKRILDPRGIYRCNGTDIYKDKESTVQVHYRMCQSCVELDPATVAGIIVTDVIATLLLAL
GVFCFAGHETGRLSGAADTQALLRNDQVYQPLRDRDDAQYSHLGGNWARNK
NT seq 516 nt NT seq  +upstreamnt  +downstreamnt
atggaacatagcacgtttctctctggcctggtactggctacccttctctcgcaagtgagc
cccttcaagatacctatagaggaacttgaggacagagtgtttgtgaattgcaataccagc
atcacatgggtagagggaacggtgggaacactgctctcagacattacaagactggacctg
ggaaaacgcatcctggacccacgaggaatatataggtgtaatgggacagatatatacaag
gacaaagaatctaccgtgcaagttcattatcgaatgtgccagagctgtgtggagctggat
ccagccaccgtggctggcatcattgtcactgatgtcattgccactctgctccttgctttg
ggagtcttctgctttgctggacatgagactggaaggctgtctggggctgccgacacacaa
gctctgttgaggaatgaccaggtctatcagcccctccgagatcgagatgatgctcagtac
agccaccttggaggaaactgggctcggaacaagtga

DBGET integrated database retrieval system