KEGG   Homo sapiens (human): 9152
Entry
9152              CDS       T01001                                 

Gene name
SLC6A5, GLYT-2, GLYT2, HKPX3, NET1
Definition
(RefSeq) solute carrier family 6 member 5
  KO
K05038  solute carrier family 6 (neurotransmitter transporter, glycine) member 5/9
Organism
hsa  Homo sapiens (human)
Pathway
hsa04721  Synaptic vesicle cycle
Disease
H00769  Hyperekplexia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09156 Nervous system
   04721 Synaptic vesicle cycle
    9152 (SLC6A5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    9152 (SLC6A5)
Transporters [BR:hsa02000]
 Solute carrier family (SLC)
  SLC6: Sodium- and chloride-dependent neurotransmitter transporter
   9152 (SLC6A5)
SSDB
Motif
Pfam: SNF DUF999
Other DBs
NCBI-GeneID: 9152
NCBI-ProteinID: NP_004202
OMIM: 604159
HGNC: 11051
Ensembl: ENSG00000165970
Vega: OTTHUMG00000166024
Pharos: Q9Y345(Tchem)
UniProt: Q9Y345 Q4VAM6 Q4VAM4
Position
11p15.1
AA seq 797 aa
MDCSAPKEMNKLPANSPEAAAAQGHPDGPCAPRTSPEQELPAAAAPPPPRVPRSASTGAQ
TFQSADARACEAERPGVGSCKLSSPRAQAASAALRDLREAQGAQASPPPGSSGPGNALHC
KIPFLRGPEGDANVSVGKGTLERNNTPVVGWVNMSQSTVVLATDGITSVLPGSVATVATQ
EDEQGDENKARGNWSSKLDFILSMVGYAVGLGNVWRFPYLAFQNGGGAFLIPYLMMLALA
GLPIFFLEVSLGQFASQGPVSVWKAIPALQGCGIAMLIISVLIAIYYNVIICYTLFYLFA
SFVSVLPWGSCNNPWNTPECKDKTKLLLDSCVISDHPKIQIKNSTFCMTAYPNVTMVNFT
SQANKTFVSGSEEYFKYFVLKISAGIEYPGEIRWPLALCLFLAWVIVYASLAKGIKTSGK
VVYFTATFPYVVLVILLIRGVTLPGAGAGIWYFITPKWEKLTDATVWKDAATQIFFSLSA
AWGGLITLSSYNKFHNNCYRDTLIVTCTNSATSIFAGFVIFSVIGFMANERKVNIENVAD
QGPGIAFVVYPEALTRLPLSPFWAIIFFLMLLTLGLDTMFATIETIVTSISDEFPKYLRT
HKPVFTLGCCICFFIMGFPMITQGGIYMFQLVDTYAASYALVIIAIFELVGISYVYGLQR
FCEDIEMMIGFQPNIFWKVCWAFVTPTILTFILCFSFYQWEPMTYGSYRYPNWSMVLGWL
MLACSVIWIPIMFVIKMHLAPGRFIERLKLVCSPQPDWGPFLAQHRGERYKNMIDPLGTS
SLGLKLPVKDLELGTQC
NT seq 2394 nt   +upstreamnt  +downstreamnt
atggattgcagtgctcccaaggaaatgaataaactgccagccaacagcccggaggcggcg
gcggcgcagggccacccggatggcccatgcgctcccaggacgagcccggagcaggagctt
cccgcggctgccgccccgccgccgccacgtgtgcccaggtccgcttccaccggcgcccaa
actttccagtcagcggacgcgcgagcctgcgaggctgagcggccaggagtggggtcttgc
aaactcagtagcccgcgggcgcaggcggcctctgcagctctgcgggacttgagagaggcg
caaggcgcgcaggcctcgccccctcccgggagctccgggcccggcaacgcgctgcactgt
aagatcccttttctgcgaggcccggagggggatgcgaacgtgagtgtgggcaagggcacc
ctggagcggaacaatacccctgttgtgggctgggtgaacatgagccagagcaccgtggtg
ctggccacggatggaatcacgtccgtgctcccgggcagcgtggccaccgttgccacccag
gaggacgagcaaggggatgagaataaggcccgagggaactggtccagcaaactggacttc
atcctgtccatggtggggtacgcagtggggctgggcaatgtctggaggtttccctacctg
gccttccagaacgggggaggtgctttcctcatcccttacctgatgatgctggctctggct
ggattacccatcttcttcttggaggtgtcgctgggccagtttgccagccagggaccagtg
tctgtgtggaaggccatcccagctctacaaggctgtggcatcgcgatgctgatcatctct
gtcctaatagccatatactacaatgtgattatttgctatacacttttctacctgtttgcc
tcctttgtgtctgtactaccctggggctcctgcaacaacccttggaatacgccagaatgc
aaagataaaaccaaacttttattagattcctgtgttatcagtgaccatcccaaaatacag
atcaagaactcgactttctgcatgaccgcttatcccaacgtgacaatggttaatttcacc
agccaggccaataagacatttgtcagtggaagtgaagagtacttcaagtactttgtgctg
aagatttctgcagggattgaatatcctggcgagatcaggtggccactagctctctgcctc
ttcctggcttgggtcattgtgtatgcatcattggctaaaggaatcaagacttcaggaaaa
gtggtgtacttcacggccacgttcccgtatgtcgtactcgtgatcctcctcatccgagga
gtcaccctgcctggagctggagctgggatctggtacttcatcacacccaagtgggagaaa
ctcacggatgccacggtgtggaaagatgctgccactcagattttcttctctttatctgct
gcatggggaggcctgatcactctctcttcttacaacaaattccacaacaactgctacagg
gacactctaattgtcacctgcaccaacagtgccacaagcatctttgccggcttcgtcatc
ttctccgttatcggcttcatggccaatgaacgcaaagtcaacattgagaatgtggcagac
caagggccaggcattgcatttgtggtttacccggaagccttaaccaggctgcctctctct
ccgttctgggccatcatctttttcctgatgctcctcactcttggacttgacactatgttt
gccaccatcgagaccatagtgacctccatctcagacgagtttcccaagtacctacgcaca
cacaagccagtgtttactctgggctgctgcatttgtttcttcatcatgggttttccaatg
atcactcagggtggaatttacatgtttcagcttgtggacacctatgctgcctcctatgcc
cttgtcatcattgccatttttgagctcgtggggatctcttatgtgtatggcttgcaaaga
ttctgtgaagatatagagatgatgattggattccagcctaacatcttctggaaagtctgc
tgggcatttgtaaccccaaccattttaacctttatcctttgcttcagcttttaccagtgg
gagcccatgacctatggctcttaccgctatcctaactggtccatggtgctcggatggcta
atgctcgcctgttccgtcatctggatcccaattatgtttgtgataaaaatgcatctggcc
cctggaagatttattgagaggctgaagttggtgtgctcgccacagccggactggggccca
ttcttagctcaacaccgcggggagcgttacaagaacatgatcgaccccttgggaacctct
tccttgggactcaaactgccagtgaaggatttggaactgggcactcagtgctag

DBGET integrated database retrieval system