KEGG   Homo sapiens (human): 91522
Entry
91522             CDS       T01001                                 
Symbol
COL23A1
Name
(RefSeq) collagen type XXIII alpha 1 chain
  KO
K24355  collagen type XXIII alpha
Organism
hsa  Homo sapiens (human)
Pathway
hsa04974  Protein digestion and absorption
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09154 Digestive system
   04974 Protein digestion and absorption
    91522 (COL23A1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:hsa00536]
    91522 (COL23A1)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate / Heparin
  Extracellular matrix molecules
   91522 (COL23A1)
SSDB
Motif
Pfam: Collagen
Other DBs
NCBI-GeneID: 91522
NCBI-ProteinID: NP_775736
OMIM: 610043
HGNC: 22990
Ensembl: ENSG00000050767
Position
5:complement(178237618..178590393)
AA seq 540 aa
MGPGERAGGGGDAGKGNAAGGGGGGRSATTAGSRAVSALCLLLSVGSAAACLLLGVQAAA
LQGRVAALEEERELLRRAGPPGALDAWAEPHLERLLREKLDGLAKIRTAREAPSECVCPP
GPPGRRGKPGRRGDPGPPGQSGRDGYPGPLGLDGKPGLPGPKGEKGAPGDFGPRGDQGQD
GAAGPPGPPGPPGARGPPGDTGKDGPRGAQGPAGPKGEPGQDGEMGPKGPPGPKGEPGVP
GKKGDDGTPSQPGPPGPKGEPGSMGPRGENGVDGAPGPKGEPGHRGTDGAAGPRGAPGLK
GEQGDTVVIDYDGRILDALKGPPGPQGPPGPPGIPGAKGELGLPGAPGIDGEKGPKGQKG
DPGEPGPAGLKGEAGEMGLSGLPGADGLKGEKGESASDSLQESLAQLIVEPGPPGPPGPP
GPMGLQGIQGPKGLDGAKGEKGASGERGPSGLPGPVGPPGLIGLPGTKGEKGRPGEPGLD
GFPGPRGEKGDRSERGEKGERGVPGRKGVKGQKGEPGPPGLDQPCPVGPDGLPVPGCWHK
NT seq 1623 nt   +upstreamnt  +downstreamnt
atgggcccaggcgagcgcgccggtggcggcggcgacgcggggaagggcaatgcggcgggc
ggcggcggcggagggcgctcggcgacgacggccgggtcccgggcggtgagcgcgctgtgc
ctgctgctctccgtgggctcggcggctgcctgcctgctgctgggtgtccaggcggccgcg
ctgcagggccgggtggcggcgctcgaggaggagcgggagctgctgcggcgcgcggggccg
ccaggcgccctggacgcctgggccgagccgcacctggagcgcctgctgcgggagaagttg
gacggactagcgaagatccggactgctcgggaagctccatccgaatgtgtctgcccccca
gggccccctggacggcgcggcaagcctgggagaagaggcgaccctggtcctccagggcaa
tcaggacgagatggctacccgggacccctgggtttggatggcaagcccggacttccaggc
ccgaaaggggaaaagggtgcaccaggagactttggcccccggggagaccaaggacaagat
ggagctgctgggcctccggggccccctggacctcctggggcccggggccctcctggcgac
actgggaaagatggccccaggggagcacaaggcccagcgggccccaaaggagagcccgga
caagacggcgagatgggcccaaagggacccccagggcccaagggtgagcctggagtacct
ggaaagaagggcgacgatgggacaccaagccagcctggaccaccagggcccaagggcgag
ccagggagcatggggcctcggggagagaacggtgtggacggtgccccaggaccgaagggg
gagcctggccaccgaggcacggatggagctgcagggccccggggtgccccaggcctcaag
ggcgagcagggagacacagtggtgatcgactatgatggcaggatcttggatgccctcaag
gggcctcccggaccacaggggcccccagggccaccagggatccctggagccaagggcgag
cttggattgcccggtgccccaggaatcgatggagagaagggccccaaaggacagaaagga
gacccaggagagcctgggccagcaggactcaaaggggaagcaggcgagatgggcttgtcc
ggcctcccgggcgctgacggcctcaagggggagaagggggagtcggcgtctgacagccta
caggagagcctggctcagctcatagtggagccagggccccctggcccccctggcccccca
ggcccgatgggcctccagggaatccagggtcccaagggcttggatggagcaaagggagag
aagggtgcgtcgggtgagagaggccccagcggcctgcctgggccagttggcccaccgggc
cttattgggctgccaggaaccaaaggagagaagggcagacccggggagccaggactagat
ggtttccctggaccccgaggagagaaaggtgatcggagcgagcgtggagagaagggagaa
cgaggggtccccggccggaaaggagtgaagggccagaagggcgagccgggaccaccaggc
ctggaccagccgtgtcccgtgggccccgacgggctgcctgtgcctggctgctggcataag
tga

DBGET integrated database retrieval system