KEGG   Homo sapiens (human): 91522Help
Entry
91522             CDS       T01001                                 

Gene name
COL23A1
Definition
(RefSeq) collagen type XXIII alpha 1 chain
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: Collagen
Motif
Other DBs
NCBI-GeneID: 91522
NCBI-ProteinID: NP_775736
OMIM: 610043
HGNC: 22990
Ensembl: ENSG00000050767
Vega: OTTHUMG00000130890
Pharos: Q86Y22(Tbio)
UniProt: Q86Y22
Position
5q35.3
AA seq 540 aa AA seqDB search
MGPGERAGGGGDAGKGNAAGGGGGGRSATTAGSRAVSALCLLLSVGSAAACLLLGVQAAA
LQGRVAALEEERELLRRAGPPGALDAWAEPHLERLLREKLDGLAKIRTAREAPSECVCPP
GPPGRRGKPGRRGDPGPPGQSGRDGYPGPLGLDGKPGLPGPKGEKGAPGDFGPRGDQGQD
GAAGPPGPPGPPGARGPPGDTGKDGPRGAQGPAGPKGEPGQDGEMGPKGPPGPKGEPGVP
GKKGDDGTPSQPGPPGPKGEPGSMGPRGENGVDGAPGPKGEPGHRGTDGAAGPRGAPGLK
GEQGDTVVIDYDGRILDALKGPPGPQGPPGPPGIPGAKGELGLPGAPGIDGEKGPKGQKG
DPGEPGPAGLKGEAGEMGLSGLPGADGLKGEKGESASDSLQESLAQLIVEPGPPGPPGPP
GPMGLQGIQGPKGLDGAKGEKGASGERGPSGLPGPVGPPGLIGLPGTKGEKGRPGEPGLD
GFPGPRGEKGDRSERGEKGERGVPGRKGVKGQKGEPGPPGLDQPCPVGPDGLPVPGCWHK
NT seq 1623 nt NT seq  +upstreamnt  +downstreamnt
atgggcccaggcgagcgcgccggtggcggcggcgacgcggggaagggcaatgcggcgggc
ggcggcggcggagggcgctcggcgacgacggccgggtcccgggcggtgagcgcgctgtgc
ctgctgctctccgtgggctcggcggctgcctgcctgctgctgggtgtccaggcggccgcg
ctgcagggccgggtggcggcgctcgaggaggagcgggagctgctgcggcgcgcggggccg
ccaggcgccctggacgcctgggccgagccgcacctggagcgcctgctgcgggagaagttg
gacggactagcgaagatccggactgctcgggaagctccatccgaatgtgtctgcccccca
gggccccctggacggcgcggcaagcctgggagaagaggcgaccctggtcctccagggcaa
tcaggacgagatggctacccgggacccctgggtttggatggcaagcccggacttccaggc
ccgaaaggggaaaagggtgcaccaggagactttggcccccggggagaccaaggacaagat
ggagctgctgggcctccggggccccctggacctcctggggcccggggccctcctggcgac
actgggaaagatggccccaggggagcacaaggcccagcgggccccaaaggagagcccgga
caagacggcgagatgggcccaaagggacccccagggcccaagggtgagcctggagtacct
ggaaagaagggcgacgatgggacaccaagccagcctggaccaccagggcccaagggcgag
ccagggagcatggggcctcggggagagaacggtgtggacggtgccccaggaccgaagggg
gagcctggccaccgaggcacggatggagctgcagggccccggggtgccccaggcctcaag
ggcgagcagggagacacagtggtgatcgactatgatggcaggatcttggatgccctcaag
gggcctcccggaccacaggggcccccagggccaccagggatccctggagccaagggcgag
cttggattgcccggtgccccaggaatcgatggagagaagggccccaaaggacagaaagga
gacccaggagagcctgggccagcaggactcaaaggggaagcaggcgagatgggcttgtcc
ggcctcccgggcgctgacggcctcaagggggagaagggggagtcggcgtctgacagccta
caggagagcctggctcagctcatagtggagccagggccccctggcccccctggcccccca
ggcccgatgggcctccagggaatccagggtcccaagggcttggatggagcaaagggagag
aagggtgcgtcgggtgagagaggccccagcggcctgcctgggccagttggcccaccgggc
cttattgggctgccaggaaccaaaggagagaagggcagacccggggagccaggactagat
ggtttccctggaccccgaggagagaaaggtgatcggagcgagcgtggagagaagggagaa
cgaggggtccccggccggaaaggagtgaagggccagaagggcgagccgggaccaccaggc
ctggaccagccgtgtcccgtgggccccgacgggctgcctgtgcctggctgctggcataag
tga

DBGET integrated database retrieval system