KEGG   Homo sapiens (human): 91526Help
Entry
91526             CDS       T01001                                 

Gene name
ANKRD44, PP6-ARS-B
Definition
(RefSeq) ankyrin repeat domain 44
  KO
K15503  serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:hsa01009]
    91526 (ANKRD44)
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:hsa03400]
    91526 (ANKRD44)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-6
    Regulatory subunits
     91526 (ANKRD44)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   Other DSBR factors
    Protein phosphatase 6
     91526 (ANKRD44)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ank_2 Ank_4 Ank Ank_3 Ank_5
Motif
Other DBs
NCBI-GeneID: 91526
NCBI-ProteinID: NP_001182073
HGNC: 25259
Ensembl: ENSG00000065413
Vega: OTTHUMG00000154411
Pharos: Q8N8A2(Tdark)
UniProt: Q8N8A2
Position
2q33.1
AA seq 993 aa AA seqDB search
MAVLKLTDQPPLVQAIFSGDPEEIRMLIHKTEDVNTLDSEKRTPLHVAAFLGDAEIIELL
ILSGARVNAKDNMWLTPLHRAVASRSEEAVQVLIKHSADVNARDKNWQTPLHVAAANKAV
KCAEVIIPLLSSVNVSDRGGRTALHHAALNGHVEMVNLLLAKGANINAFDKKDRRALHWA
AYMGHLDVVALLINHGAEVTCKDKKGYTPLHAAASNGQINVVKHLLNLGVEIDEINVYGN
TALHIACYNGQDAVVNELIDYGANVNQPNNNGFTPLHFAAASTHGALCLELLVNNGADVN
IQSKDGKSPLHMTAVHGRFTRSQTLIQNGGEIDCVDKDGNTPLHVAARYGHELLINTLIT
SGADTAKCGIHSMFPLHLAALNAHSDCCRKLLSSGFEIDTPDKFGRTCLHAAAAGGNVEC
IKLLQSSGADFHKKDKCGRTPLHYAAANCHFHCIETLVTTGANVNETDDWGRTALHYAAA
SDMDRNKTILGNAHDNSEELERARELKEKEATLCLEFLLQNDANPSIRDKEGYNSIHYAA
AYGHRQCLELLLERTNSGFEESDSGATKSPLHLAAYNGHHQALEVLLQSLVDLDIRDEKG
RTALDLAAFKGHTECVEALINQGASIFVKDNVTKRTPLHASVINGHTLCLRLLLEIADNP
EAVDVKDAKGQTPLMLAVAYGHIDAVSLLLEKEANVDTVDILGCTALHRGIMTGHEECVQ
MLLEQEVSILCKDSRGRTPLHYAAARGHATWLSELLQMALSEEDCCFKDNQGYTPLHWAC
YNGNENCIEVLLEQKCFRKFIGNPFTPLHCAIINDHGNCASLLLGAIDSSIVSCRDDKGR
TPLHAAAFADHVECLQLLLRHSAPVNAVDNSGKTALMMAAENGQAGAVDILVNSAQADLT
VKDKDLNTPLHLACSKGHEKCALLILDKIQDESLINEKNNALQTPLHVAARNGLKVVVEE
LLAKGACVLAVDENASRSNGPRSTPGTAVQKEE
NT seq 2982 nt NT seq  +upstreamnt  +downstreamnt
atggcagtgctcaaactcaccgaccagccaccattggttcaggcaatcttcagcggtgat
ccagaggagatccggatgctcatccataaaactgaagatgtgaatactctggattctgag
aaacgaacccctcttcatgtggccgcatttctgggagatgcagagatcattgaactcctg
attttgtcaggagctcgtgtaaatgccaaggacaacatgtggctgactccactgcaccgg
gctgttgcttccagaagtgaagaagcagtacaggttttgattaagcactcagctgatgtc
aatgcaagggacaagaactggcagacccctcttcatgtggcagcagccaacaaggctgtc
aaatgtgcagaagtgatcattcccctgctgagcagtgtcaatgtctccgaccgagggggg
cgcacagccttgcaccatgcggctctgaacggccacgtggagatggtcaatttactcttg
gccaaaggggcaaatatcaatgcatttgacaagaaggaccggcgtgctctgcactgggca
gcatacatgggccacttggatgttgtagcattgctcattaaccatggcgcagaagtgacc
tgtaaggataagaagggttatacccctctgcatgctgcagcctccaatggacagattaat
gttgtcaagcatctcctgaacctgggggtggagattgatgaaatcaatgtctatggaaat
acagcgcttcacatcgcctgctacaatggacaggatgctgtggttaacgagttgattgac
tacggtgctaacgtgaaccagccaaacaataatgggttcacccctttgcattttgctgct
gcctccactcatggtgctttgtgtcttgaattgttagtaaacaacggggcagatgttaac
attcagagtaaagatggcaaaagtccactgcacatgacagctgtccatggaaggttcaca
cggtcacagaccctcattcagaatggaggtgaaattgactgtgtggataaggacggcaac
actcctctccatgtggctgcaagatacggtcatgagcttttgattaacaccttaataacc
agcggagctgacacagccaagtgtggaatccatagcatgttccctttacatttagctgcc
ctaaatgctcactctgactgctgcagaaagttgttatcatcgggctttgaaatagacacc
ccagataaatttggaagaacgtgccttcatgctgctgctgcaggaggtaatgtggaatgt
ataaaactcttgcagagcagcggagcagatttccataaaaaggacaagtgtgggaggacc
cctttgcactatgcagctgcgaattgtcatttccactgtattgagacattagtgaccaca
ggggccaacgttaatgaaacagatgactggggacgcacagctttgcattacgccgctgca
tcagacatggatagaaataagactatcttaggaaatgcccatgataattcagaagaactt
gaaagagccagggagctgaaggaaaaggaagccacactatgtctagagtttctgcttcaa
aatgatgcaaatccatctatccgggacaaggaaggttacaatagcatacattatgctgcc
gcctatgggcacaggcagtgtctggaattgcttttggaaagaacaaacagtggatttgaa
gaatcagattctggtgctactaagagtccactccacttagctgcctacaatgggcaccat
caagccttggaagtccttctgcagtcgttggtggacctggacatcagggatgagaaaggc
cgcactgctctggatctggctgcctttaaaggacacacagaatgtgtggaagcgcttatc
aatcagggcgcatccatctttgtgaaagacaatgtaaccaaaagaaccccacttcatgcc
tcagtaattaatggtcacacactgtgtttacggctgttgctagaaattgcagacaacccg
gaggcggtcgatgtgaaagatgccaaaggacaaacaccactgatgcttgcagtagcatat
ggacatattgacgctgtttcattgttacttgaaaaggaagccaacgtagacactgttgac
atcctaggatgcacagctttacacagagggattatgacaggacacgaggaatgtgtgcaa
atgctgctggaacaagaagtgtcaattctctgtaaagattccagagggaggacgcccttg
cactatgcagctgctcgtggccacgccacgtggctgagcgagctgctccaaatggctctt
tctgaggaggactgttgtttcaaagataaccaaggctacacgccgctgcactgggcttgt
tacaatggtaatgaaaactgtatagaggtacttttggagcaaaaatgttttcgcaaattt
atcggtaatccctttactccactgcactgtgcaataatcaatgatcatgggaattgtgca
tcattgctgcttggggccatagattccagtatcgtcagttgtagagatgacaaaggcagg
acaccccttcatgcggcagcatttgctgatcatgtggagtgcttgcagcttcttctgaga
cacagtgctccagtgaacgcagtagataattcagggaaaacagcactgatgatggctgct
gagaatgggcaggcaggcgctgtggatattttggtgaacagtgcccaggctgatctgact
gtaaaggataaggacttgaatacacccttacatttggcttgtagtaaaggtcatgaaaaa
tgtgccttgttaatacttgacaagatacaagacgagagccttattaatgaaaaaaataat
gcactgcagacacccctccacgtcgctgcgcgcaatggcttaaaggtggtagttgaggag
ttgctggccaaaggggcctgtgtacttgctgtagatgaaaatgcttctaggtcaaatgga
ccccgttccacacctggaaccgctgtacaaaaagaagaatga

DBGET integrated database retrieval system