KEGG   Homo sapiens (human): 9153Help
Entry
9153              CDS       T01001                                 

Gene name
SLC28A2, CNT2, HCNT2, HsT17153, SPNT1
Definition
(RefSeq) solute carrier family 28 member 2
  KO
K11536  pyrimidine nucleoside transport protein
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    9153 (SLC28A2)
Transporters [BR:hsa02000]
 Solute carrier family (SLC)
  SLC28: Na+-coupled nucleoside transporter
   9153 (SLC28A2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Nucleos_tra2_C Nucleos_tra2_N Gate
Motif
Other DBs
NCBI-GeneID: 9153
NCBI-ProteinID: NP_004203
OMIM: 606208
HGNC: 11002
Ensembl: ENSG00000137860
Vega: OTTHUMG00000131426
Pharos: O43868(Tchem)
UniProt: O43868 Q2M2A7 Q53H72
Position
15q21.1
AA seq 658 aa AA seqDB search
MEKASGRQSIALSTVETGTVNPGLELMEKEVEPEGSKRTDAQGHSLGDGLGPSTYQRRSR
WPFSKARSFCKTHASLFKKILLGLLCLAYAAYLLAACILNFQRALALFVITCLVIFVLVH
SFLKKLLGKKLTRCLKPFENSRLRLWTKWVFAGVSLVGLILWLALDTAQRPEQLIPFAGI
CMFILILFACSKHHSAVSWRTVFSGLGLQFVFGILVIRTDLGYTVFQWLGEQVQIFLNYT
VAGSSFVFGDTLVKDVFAFQALPIIIFFGCVVSILYYLGLVQWVVQKVAWFLQITMGTTA
TETLAVAGNIFVGMTEAPLLIRPYLGDMTLSEIHAVMTGGFATISGTVLGAFIAFGVDAS
SLISASVMAAPCALASSKLAYPEVEESKFKSEEGVKLPRGKERNVLEAASNGAVDAIGLA
TNVAANLIAFLAVLAFINAALSWLGELVDIQGLTFQVICSYLLRPMVFMMGVEWTDCPMV
AEMVGIKFFINEFVAYQQLSQYKNKRLSGMEEWIEGEKQWISVRAEIITTFSLCGFANLS
SIGITLGGLTSIVPHRKSDLSKVVVRALFTGACVSLISACMAGILYVPRGAEADCVSFPN
TSFTNRTYETYMCCRGLFQSTSLNGTNPPSFSGPWEDKEFSAMALTNCCGFYNNTVCA
NT seq 1977 nt NT seq  +upstreamnt  +downstreamnt
atggagaaagcaagtggaagacagtccattgctctgtccacagtggagactggcacagtg
aacccggggctggagctcatggaaaaagaagtagagcctgagggaagcaagaggactgac
gcacaaggacacagcctgggggatggactgggcccttccacttaccagaggaggagtcgg
tggcctttcagcaaagcaagaagtttctgcaaaacacacgccagcttgttcaagaagatc
ctgttgggcctgttgtgtttggcctatgctgcctatctcctggcagcttgcatcttgaat
ttccagagggcactggccttgtttgtcatcacctgcttggtgatctttgtcctggttcac
tcgtttttgaaaaagctcctgggcaaaaaattaacaagatgtctgaagccctttgaaaac
tcccgcctgaggctttggacgaaatgggtgtttgcaggagtctccttggttggccttata
ctgtggttggctttagacacagcccaaaggccagagcagctgatcccctttgcaggaatc
tgcatgttcatccttatcctctttgcctgctccaaacaccacagcgcagtgtcctggagg
acagtgttttcgggcctaggtcttcaatttgtctttgggatcttggtcatcagaactgat
cttggatatactgtatttcagtggctgggagagcaggtccagattttcctgaactacact
gtggccggctccagttttgtctttggggatacactggtcaaggatgtctttgcttttcag
gccttaccaatcatcattttctttggatgtgtggtgtccattctctactacctgggcctt
gtgcaatgggtagttcagaaggtcgcctggtttttacaaatcactatgggcaccactgct
acagagaccctggctgtggcaggaaacatctttgtgggtatgacagaggcacctctgctc
atccgtccctaccttggggacatgacactctctgaaatccatgcggtgatgactggaggg
tttgccaccatttctggcactgtgctgggagccttcatagcctttggggttgatgcatca
tccctgatttctgcctctgtgatggccgccccttgtgctctcgcctcatcaaagctagcg
tatccggaagtggaggagtccaagttcaagagtgaggagggggtaaagctgccccgtggg
aaggagaggaatgtcctggaagctgccagcaacggagccgtagatgccataggccttgct
actaatgtagcagccaacctgattgcctttttggctgtgttggccttcatcaatgctgcc
ctctcctggctgggggaattggtggacatacaggggctcactttccaggtcatctgctcc
tatctcctaaggcccatggttttcatgatgggtgtagagtggacagactgtccaatggtg
gctgagatggtgggaatcaagttcttcataaatgagtttgtggcttatcagcaactgtct
caatacaagaacaaacgtctctctggaatggaggagtggattgagggagagaaacagtgg
atttctgtgagagctgaaatcattacaacattttcactctgtggatttgccaatcttagt
tccataggaatcacacttggaggcttgacatcaatagtacctcaccggaagagtgacttg
tccaaggttgtggtcagggccctcttcacaggggcctgtgtatcccttatcagtgcctgt
atggcaggaatcctctatgtccccaggggagctgaagctgactgtgtctccttcccaaac
acaagtttcaccaatagaacctatgagacctacatgtgctgcagagggctctttcagagt
acttctctgaatggcaccaaccctccttctttttctggtccctgggaagataaggagttc
agtgctatggcccttactaactgctgtggattctacaacaataccgtctgtgcctaa

DBGET integrated database retrieval system