KEGG   Homo sapiens (human): 9154
Entry
9154              CDS       T01001                                 

Symbol
SLC28A1, CNT1, HCNT1, URCTU
Name
(RefSeq) solute carrier family 28 member 1
  KO
K11536  pyrimidine nucleoside transport protein
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    9154 (SLC28A1)
Transporters [BR:hsa02000]
 Solute carrier family (SLC)
  SLC28: Na+-coupled nucleoside transporter
   9154 (SLC28A1)
SSDB
Motif
Pfam: Nucleos_tra2_C Nucleos_tra2_N Gate
Other DBs
NCBI-GeneID: 9154
NCBI-ProteinID: NP_001274691
OMIM: 606207
HGNC: 11001
Ensembl: ENSG00000156222
Vega: OTTHUMG00000148668
Pharos: O00337(Tbio)
UniProt: O00337 B7Z3L6
Position
15q25.3
AA seq 649 aa
MENDPSRRRESISLTPVAKGLENMGADFLESLEEGQLPRSDLSPAEIRSSWSEAAPKPFS
RWRNLQPALRARSFCREHMQLFRWIGTGLLCTGLSAFLLVACLLDFQRALALFVLTCVVL
TFLGHRLLKRLLGPKLRRFLKPQGHPRLLLWFKRGLALAAFLGLVLWLSLDTSQRPEQLV
SFAGICVFVALLFACSKHHCAVSWRAVSWGLGLQFVLGLLVIRTEPGFIAFEWLGEQIRI
FLSYTKAGSSFVFGEALVKDVFAFQVLPIIVFFSCVISVLYHVGLMQWVILKIAWLMQVT
MGTTATETLSVAGNIFVSQTEAPLLIRPYLADMTLSEVHVVMTGGYATIAGSLLGAYISF
GIDATSLIAASVMAAPCALALSKLVYPEVEESKFRREEGVKLTYGDAQNLIEAASTGAAI
SVKVVANIAANLIAFLAVLDFINAALSWLGDMVDIQGLSFQLICSYILRPVAFLMGVAWE
DCPVVAELLGIKLFLNEFVAYQDLSKYKQRRLAGAEEWVGDRKQWISVRAEVLTTFALCG
FANFSSIGIMLGGLTSMVPQRKSDFSQIVLRALFTGACVSLVNACMAGILYMPRGAEVDC
MSLLNTTLSSSSFEIYQCCREAFQSVNPEFSPEALDNCCRFYNHTICAQ
NT seq 1950 nt   +upstreamnt  +downstreamnt
atggagaacgacccctcgagacgaagagagtccatctctctcacacctgtggccaagggt
ctggagaacatgggggctgatttcttggaaagcctggaggaaggccagctccctaggagt
gacttgagccccgcagagatcaggagcagctggagcgaggcggcgccgaagcccttctcc
agatggaggaacctgcagccagccctgagagccagaagcttctgcagggagcacatgcag
ctgtttcgatggatcggcacaggcctgctctgcactgggctctctgccttcctgctggtg
gcctgcctcctggatttccagagggccctggctctgtttgtcctcacctgtgtggtcctc
accttcctgggccaccgcctgctgaaacggcttctggggccaaagctgaggaggtttctc
aagcctcagggccatccccgcctgctgctctggtttaagaggggtctagctcttgctgct
ttcctgggcctggtcctgtggctgtctctggacacctcccagcggcctgagcaactggtg
tccttcgcaggaatctgcgtgttcgtcgctctcctctttgcctgctcaaagcatcattgc
gcagtgtcctggagggccgtgtcttggggacttggactgcagtttgtacttggactcctc
gtcatcagaacagaaccaggattcattgcgttcgagtggctgggcgagcagatccggatc
ttcctgagctacacgaaggctggctccagcttcgtgtttggggaggcgctggtcaaggat
gtctttgcctttcaggttctgcccatcattgtctttttcagctgtgtcatatccgttctc
taccacgtgggcctcatgcagtgggtgatcctgaagattgcctggctgatgcaagtcacc
atgggcaccacagccactgagaccctgagtgtggctggaaacatctttgtgagccagacc
gaggctccattactgatccggccctacttggcagacatgacactctctgaagtccacgtt
gtcatgaccggaggttacgccaccattgctggcagcctgctgggtgcctacatctccttt
gggatcgatgccacctcgttgattgcagcctctgtgatggctgccccttgtgccttggcc
ctctccaagctggtctacccggaggtggaggagtccaagtttaggagggaggaaggagtg
aaactgacctatggagatgctcagaacctcatagaagcagccagcactggggccgccatc
tccgtgaaggtggtcgccaacatcgctgccaacctgattgcgttcctggctgtgctggac
tttatcaatgctgccctctcctggctgggagacatggtggacatccaagggctcagcttc
cagctcatctgctcctacatcctgcggcctgtagccttcttgatgggtgtggcgtgggag
gactgcccagtggtagctgagctgctggggatcaagctgtttctgaacgagtttgtggcc
tatcaagacctctccaagtacaagcaacgccgcctggcaggggccgaggagtgggtcggc
gacaggaagcagtggatctccgtcagagctgaagtcctcacgacgtttgccctctgtgga
tttgccaatttcagctccattgggatcatgctgggaggcttgacctccatggtcccccaa
cggaagagcgacttctcccagatagtgctccgggcgctcttcacgggagcctgtgtgtcc
ctggtgaacgcctgtatggcagggatcctctacatgcccaggggggctgaagttgactgc
atgtccctcttgaacacgaccctcagcagcagtagctttgagatttaccagtgctgccgt
gaggccttccagagcgtcaatccagagttcagcccagaggccctggacaactgctgtcgg
ttttacaaccacacgatctgtgcacagtga

DBGET integrated database retrieval system