KEGG   Homo sapiens (human): 91574Help
Entry
91574             CDS       T01001                                 

Gene name
C12orf65, COXPD7, SPG55
Definition
(RefSeq) chromosome 12 open reading frame 65
Organism
hsa  Homo sapiens (human)
Disease
H00266  Hereditary spastic paraplegia (SPG)
H00891  Combined oxidative phosphorylation deficiency (COXPD)
SSDB OrthologParalogGFIT
Motif
Pfam: RF-1
Motif
Other DBs
NCBI-GeneID: 91574
NCBI-ProteinID: NP_001137377
OMIM: 613541
HGNC: 26784
Ensembl: ENSG00000130921
Vega: OTTHUMG00000168852
Pharos: Q9H3J6(Tbio)
UniProt: Q9H3J6
Position
12q24.31
AA seq 166 aa AA seqDB search
MSTVGLFHFPTPLTRICPAPWGLRLWEKLTLLSPGIAVTPVQMAGKKDYPALLSLDENEL
EEQFVKGHGPGGQATNKTSNCVVLKHIPSGIVVKCHQTRSVDQNRKLARKILQEKVDVFY
NGENSPVHKEKREAAKKKQERKKRAKETLEKKKLLKELWESSKKVH
NT seq 501 nt NT seq  +upstreamnt  +downstreamnt
atgagcaccgtgggtttatttcattttcctacaccactgacccgaatatgcccggcgcca
tggggactccggctttgggagaagctgacgttgttatccccaggaatagctgtcactccg
gtccagatggcaggcaagaaggactaccctgcactgctttccttggatgagaatgaactc
gaagagcagtttgtgaaaggacacggtccagggggccaggcaaccaacaaaaccagcaac
tgcgtggtgctgaagcacatcccctcaggcatcgttgtaaagtgccatcagacaagatca
gttgatcagaacagaaagctagctcggaaaatcctacaagagaaagtagatgttttctac
aatggtgaaaacagtcctgttcacaaagaaaaacgagaagcggcgaagaaaaaacaagaa
aggaaaaaaagagcaaaggaaaccctggaaaaaaagaagctacttaaagaactgtgggag
tcaagtaaaaaggtccactga

DBGET integrated database retrieval system