KEGG   Homo sapiens (human): 91582
Entry
91582             CDS       T01001                                 

Gene name
RPS19BP1, AROS, S19BP
Definition
(RefSeq) ribosomal protein S19 binding protein 1
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: AROS
Other DBs
NCBI-GeneID: 91582
NCBI-ProteinID: NP_919307
OMIM: 610225
HGNC: 28749
Ensembl: ENSG00000187051
Vega: OTTHUMG00000151101
Pharos: Q86WX3(Tbio)
UniProt: Q86WX3 A0A024R1T1
Position
22q13.1
AA seq 136 aa
MSAALLRRGLELLAASEAPRDPPGQAKPRGAPVKRPRKTKAIQAQKLRNSAKGKVPKSAL
DEYRKRECRDHLRVNLKFLTRTRSTVAESVSQQILRQNRGRKACDRPVAKTKKKKAEGTV
FTEEDFQKFQQEYFGS
NT seq 411 nt   +upstreamnt  +downstreamnt
atgtccgccgccctgctgcggcggggcctggagctgctggcggcgtccgaggccccccgg
gaccctccaggtcaggccaagccgagaggggctccggtgaaacggccccggaagacgaag
gcaattcaggcccagaaactgcggaactcggccaagggaaaggtgcccaagtcggcactg
gacgagtaccggaagcgagagtgtcgagaccacctcagagtaaacctgaagtttctgacc
aggacgagaagcaccgtggctgagtctgtgagccagcagattttgcgccagaaccggggc
cgcaaggcctgtgaccggcctgtggccaagaccaagaagaagaaggctgagggcaccgtg
ttcaccgaggaagacttccagaagttccagcaggaatacttcggcagctag

DBGET integrated database retrieval system