KEGG   Homo sapiens (human): 91584
Entry
91584             CDS       T01001                                 

Gene name
PLXNA4, FAYV2820, PLEXA4, PLXNA4A, PLXNA4B, PRO34003
Definition
(RefSeq) plexin A4
  KO
K06820  plexin A
Organism
hsa  Homo sapiens (human)
Pathway
hsa04360  Axon guidance
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    91584 (PLXNA4)
SSDB
Motif
Pfam: Plexin_cytopl Sema TIG TIG_2 TIG_plexin PSI PSI_integrin RasGAP
Other DBs
NCBI-GeneID: 91584
NCBI-ProteinID: NP_065962
OMIM: 604280
HGNC: 9102
Ensembl: ENSG00000221866
Vega: OTTHUMG00000155108
Pharos: Q9HCM2(Tbio)
UniProt: Q9HCM2 A0A024R7A6
Structure
PDB: 
4E74

Position
7q32.3
AA seq 1894 aa
MKAMPWNWTCLLSHLLMVGMGSSTLLTRQPAPLSQKQRSFVTFRGEPAEGFNHLVVDERT
GHIYLGAVNRIYKLSSDLKVLVTHETGPDEDNPKCYPPRIVQTCNEPLTTTNNVNKMLLI
DYKENRLIACGSLYQGICKLLRLEDLFKLGEPYHKKEHYLSGVNESGSVFGVIVSYSNLD
DKLFIATAVDGKPEYFPTISSRKLTKNSEADGMFAYVFHDEFVASMIKIPSDTFTIIPDF
DIYYVYGFSSGNFVYFLTLQPEMVSPPGSTTKEQVYTSKLVRLCKEDTAFNSYVEVPIGC
ERSGVEYRLLQAAYLSKAGAVLGRTLGVHPDDDLLFTVFSKGQKRKMKSLDESALCIFIL
KQINDRIKERLQSCYRGEGTLDLAWLKVKDIPCSSALLTIDDNFCGLDMNAPLGVSDMVR
GIPVFTEDRDRMTSVIAYVYKNHSLAFVGTKSGKLKKIRVDGPRGNALQYETVQVVDPGP
VLRDMAFSKDHEQLYIMSERQLTRVPVESCGQYQSCGECLGSGDPHCGWCVLHNTCTRKE
RCERSKEPRRFASEMKQCVRLTVHPNNISVSQYNVLLVLETYNVPELSAGVNCTFEDLSE
MDGLVVGNQIQCYSPAAKEVPRIITENGDHHVVQLQLKSKETGMTFASTSFVFYNCSVHN
SCLSCVESPYRCHWCKYRHVCTHDPKTCSFQEGRVKLPEDCPQLLRVDKILVPVEVIKPI
TLKAKNLPQPQSGQRGYECILNIQGSEQRVPALRFNSSSVQCQNTSYSYEGMEINNLPVE
LTVVWNGHFNIDNPAQNKVHLYKCGAMRESCGLCLKADPDFACGWCQGPGQCTLRQHCPA
QESQWLELSGAKSKCTNPRITEIIPVTGPREGGTKVTIRGENLGLEFRDIASHVKVAGVE
CSPLVDGYIPAEQIVCEMGEAKPSQHAGFVEICVAVCRPEFMARSSQLYYFMTLTLSDLK
PSRGPMSGGTQVTITGTNLNAGSNVVVMFGKQPCLFHRRSPSYIVCNTTSSDEVLEMKVS
VQVDRAKIHQDLVFQYVEDPTIVRIEPEWSIVSGNTPIAVWGTHLDLIQNPQIRAKHGGK
EHINICEVLNATEMTCQAPALALGPDHQSDLTERPEEFGFILDNVQSLLILNKTNFTYYP
NPVFEAFGPSGILELKPGTPIILKGKNLIPPVAGGNVKLNYTVLVGEKPCTVTVSDVQLL
CESPNLIGRHKVMARVGGMEYSPGMVYIAPDSPLSLPAIVSIAVAGGLLIIFIVAVLIAY
KRKSRESDLTLKRLQMQMDNLESRVALECKEAFAELQTDIHELTSDLDGAGIPFLDYRTY
TMRVLFPGIEDHPVLRDLEVPGYRQERVEKGLKLFAQLINNKVFLLSFIRTLESQRSFSM
RDRGNVASLIMTVLQSKLEYATDVLKQLLADLIDKNLESKNHPKLLLRRTESVAEKMLTN
WFTFLLYKFLKECAGEPLFSLFCAIKQQMEKGPIDAITGEARYSLSEDKLIRQQIDYKTL
VLSCVSPDNANSPEVPVKILNCDTITQVKEKILDAIFKNVPCSHRPKAADMDLEWRQGSG
ARMILQDEDITTKIENDWKRLNTLAHYQVPDGSVVALVSKQVTAYNAVNNSTVSRTSASK
YENMIRYTGSPDSLRSRTPMITPDLESGVKMWHLVKNHEHGDQKEGDRGSKMVSEIYLTR
LLATKGTLQKFVDDLFETIFSTAHRGSALPLAIKYMFDFLDEQADKHGIHDPHVRHTWKS
NCLPLRFWVNMIKNPQFVFDIHKNSITDACLSVVAQTFMDSCSTSEHRLGKDSPSNKLLY
AKDIPSYKNWVERYYSDIGKMPAISDQDMNAYLAEQSRMHMNEFNTMSALSEIFSYVGKY
SEEILGPLDHDDQCGKQKLAYKLEQVITLMSLDS
NT seq 5685 nt   +upstreamnt  +downstreamnt
atgaaagccatgccctggaactggacctgccttctctcccacctcctcatggtgggcatg
ggctcctccactttgctcacccggcagccagccccgctgtcccagaagcagcggtcattt
gtcacattccgaggagagcccgccgagggtttcaatcacctggtggtggatgagaggaca
ggacacatttacttgggggccgtcaatcggatttacaagctctccagcgacctgaaggtc
ttggtgacgcatgagacagggccggacgaggacaaccccaagtgttacccaccccgcatc
gtccagacctgcaatgagcccctgaccaccaccaacaatgtcaacaagatgctcctcata
gactacaaggagaacaggctgattgcctgtgggagcctgtaccaaggcatctgcaagctg
ctgaggctggaggacctcttcaagctgggggagccttatcataagaaggagcactatctg
tcaggtgtcaacgagagcggctcagtctttggagtgatcgtctcctacagcaacctggat
gacaagctgttcattgccacggcagtggatgggaagcccgagtattttcccaccatctcc
agccggaaactgaccaagaactctgaggcggatggcatgttcgcgtacgtcttccatgat
gagttcgtggcctcgatgattaagatcccttcggacaccttcaccatcatccctgacttt
gatatctactatgtctatggttttagcagtggcaactttgtctactttttgaccctccaa
cctgagatggtgtctccaccaggctccaccaccaaggagcaggtgtatacatccaagctc
gtgaggctttgcaaggaggacacagccttcaactcctatgtagaggtgcccattggctgt
gagcgcagtggggtggagtaccgcctgctgcaggctgcctacctgtccaaagcgggggcc
gtgcttggcaggacccttggagtccatccagatgatgacctgctcttcaccgtcttctcc
aagggccagaagcggaaaatgaaatccctggatgagtcggccctgtgcatcttcatcttg
aagcagataaatgaccgcattaaggagcggctgcagtcttgttaccggggcgagggcacg
ctggacctggcctggctcaaggtgaaggacatcccctgcagcagtgcgctcttaaccatt
gacgataacttctgtggcctggacatgaatgctcccctgggagtgtccgacatggtgcgt
ggaattcccgtcttcacggaggacagggaccgcatgacgtctgtcatcgcatatgtctac
aagaaccactctctggcctttgtgggcaccaaaagtggcaagctgaagaagatccgggtg
gatggacccaggggcaacgccctccagtatgagacggtgcaggtggtggaccccggccca
gtcctccgggatatggccttctccaaggaccacgagcaactctacatcatgtcagagagg
cagctcaccagagtccctgtggagtcctgtggtcagtatcagagctgcggcgagtgcctt
ggctcaggcgacccccactgtggctggtgtgtgctgcacaacacttgcacccggaaggag
cggtgtgagcggtccaaggagccccgcaggtttgcctcggagatgaagcagtgtgtccgg
ctgacggtccatcccaacaatatctccgtctctcagtacaacgtgctgctggtcctggag
acgtacaatgtcccggagctgtcagctggcgtcaactgcacctttgaggacctgtcagag
atggatgggctggtcgtgggcaatcagatccagtgctactcccctgcagccaaggaggtg
ccccggatcatcacagagaatggggaccaccatgtcgtacagcttcagctcaaatcaaag
gagaccggcatgaccttcgccagcaccagctttgtcttctacaattgcagcgtccacaat
tcgtgcctgtcctgcgtggagagtccataccgctgccactggtgtaaataccggcatgtc
tgcacccatgaccccaagacctgctccttccaggaaggccgagtgaagctgcccgaggac
tgcccccagctgctgcgagtggacaagatcctggtgcccgtggaggtgatcaagcctatc
acgctgaaggccaagaacctcccccagccccagtctgggcagcgtggctacgaatgcatc
ctcaacattcagggcagcgagcagcgagtgcccgccctgcgcttcaacagctccagcgta
cagtgccagaacacctcttattcctatgaagggatggagatcaacaacctgcccgtggag
ttgacagtcgtgtggaatgggcacttcaacattgacaacccagctcagaataaagttcac
ctctacaagtgtggagccatgcgtgagagctgcgggctgtgcctcaaggctgacccagac
ttcgcatgtggctggtgccagggcccaggccagtgcaccctgcgccagcactgccctgcc
caggagagccagtggctggagctgtctggtgccaaaagcaagtgcacaaacccccgcatc
acagagataatcccggtgacaggcccccgggaagggggcaccaaggtcactatccgaggg
gagaacctgggcctggaatttcgcgacatcgcctcccatgtcaaggttgctggcgtggag
tgcagccctttagtggatggttacatccctgcagaacagatcgtgtgtgagatgggggag
gccaagcccagccagcatgcaggcttcgtggagatctgcgtggctgtgtgtcggcctgaa
ttcatggcccggtcctcacagctctattacttcatgacactgactctctcagatctgaag
cccagccgggggcccatgtccggagggacccaagtgaccatcacaggcaccaacctgaat
gccggaagcaacgtggtggtgatgtttggaaagcagccctgtctcttccacaggcgatct
ccatcctacattgtctgcaacaccacatcctcagatgaggtgctagagatgaaggtgtcg
gtgcaggtggacagggccaagatccaccaggacctggtctttcagtatgtggaagacccc
accatcgtgcggattgagccagaatggagcattgtcagtggaaacacacccatcgccgta
tgggggacccacctggacctcatacagaacccccagatccgtgccaagcatggagggaag
gagcacatcaatatctgtgaggttctgaacgctactgagatgacctgtcaggcgcccgcc
ctcgctctgggtcctgaccaccagtcagacctgaccgagaggcccgaggagtttggcttc
atcctggacaacgtccagtccctgctcatcctcaacaagaccaacttcacctactatccc
aacccggtgtttgaggcctttggtccctcaggaatcctggagctcaagcctggcacgccc
atcatcctaaagggcaagaacctgatcccgcctgtggctgggggcaacgtgaagctgaac
tacactgtgctggttggggagaagccgtgcaccgtgaccgtgtcagatgtccagctgctc
tgcgagtcccccaacctcatcggcaggcacaaagtgatggcccgtgtcggtggcatggag
tactccccggggatggtgtacattgccccggacagcccgctcagcctgcccgccatcgtc
agcatcgcagtggctggcggcctcctcatcattttcatcgtggccgtgctcattgcctat
aaacgcaagtcccgcgaaagtgacctcacgctgaagcggctgcagatgcagatggacaac
ctggagtcccgtgtggccctggagtgcaaggaagcctttgccgagctgcagacggacatc
catgagctgaccagtgacctggatggagccgggattccgttcctggactatagaacttac
accatgcgggtgctgttcccaggaattgaagaccaccctgtcctccgggaccttgaggtc
ccgggctaccggcaggagcgtgtggagaaaggcctgaagctcttcgcccagctcatcaac
aacaaggtgttcctgctgtccttcatccgcacgcttgagtcccagcgtagcttctccatg
cgcgaccgtggcaacgtggcctcactcatcatgaccgtgctgcagagcaagctggagtac
gccactgatgtgctgaagcagctgctggccgacctcattgacaagaacctggagagcaag
aaccaccctaagctgctgctcaggaggactgagtcagtggctgagaagatgctgaccaat
tggtttactttcctcctctacaagttcctcaaggagtgtgctggggagcccctcttctcc
ctgttctgtgccatcaagcagcagatggagaagggccccattgacgccatcacgggcgag
gcccgctactccttgagcgaggacaagctcatccgccagcagattgactacaaaaccctg
gtcctgagctgtgtcagcccagacaatgccaacagccccgaggtcccagtaaagatcctc
aactgtgacaccatcactcaggtcaaggagaagattctggatgccatcttcaagaatgtg
ccttgctcccaccggcccaaagctgcagatatggatctggagtggcgacaaggaagtggg
gcaaggatgatcttgcaggatgaagacatcaccaccaagattgagaatgattggaagcga
ctgaacacactggcccactaccaggtgccagatggttccgtggtggcattagtgtccaag
caggtgacagcctataacgcagtgaacaactccaccgtctccaggacctcagcaagtaaa
tatgaaaacatgatccggtacacgggcagccccgacagcctccgctcacggacacctatg
atcactcctgacctggagagtggagtcaagatgtggcacctagtgaagaaccacgagcac
ggagaccagaaggagggggaccgggggagcaagatggtgtctgaaatctacctgacccga
ctcctggccactaagggcacactgcagaagtttgtggatgacctctttgagaccatcttc
agcacggcacaccgtggctctgccctgcccctggccatcaagtacatgtttgacttcctg
gatgagcaggctgataaacatggcattcatgacccgcacgtccgccatacctggaagagc
aattgcctgcccctgaggttttgggtcaacatgatcaagaacccgcagtttgtgtttgac
atccataagaacagcatcacagacgcctgcctctctgtggtggctcagaccttcatggac
tcttgctccacgtcagagcaccggctgggcaaggactcgccctccaacaagctgctgtat
gccaaggacatccccagctacaagaattgggtggagaggtattactcagacatagggaag
atgccagccatcagcgaccaagacatgaacgcatacctggctgagcagtcccggatgcac
atgaatgagttcaacaccatgagtgcactctcagagatcttctcctatgtgggcaaatac
agcgaggagatccttggacctctggaccacgatgaccagtgtgggaagcagaaactggcc
tacaaactagaacaagtcataaccctcatgagcttagacagctga

DBGET integrated database retrieval system