KEGG   Homo sapiens (human): 916Help
Entry
916               CDS       T01001                                 

Gene name
CD3E, IMD18, T3E, TCRE
Definition
(RefSeq) CD3e molecule
  KO
K06451  T-cell surface glycoprotein CD3 epsilon chain
Organism
hsa  Homo sapiens (human)
Pathway
hsa04640  Hematopoietic cell lineage
hsa04658  Th1 and Th2 cell differentiation
hsa04659  Th17 cell differentiation
hsa04660  T cell receptor signaling pathway
hsa05142  Chagas disease (American trypanosomiasis)
hsa05162  Measles
hsa05166  Human T-cell leukemia virus 1 infection
hsa05169  Epstein-Barr virus infection
hsa05170  Human immunodeficiency virus 1 infection
hsa05340  Primary immunodeficiency
Disease
H00091  T-B+Severe combined immunodeficiency
Drug target
Antithymocyte immunoglobulin (rabbit): D09190
Blinatumomab: D09325
Catumaxomab: D09207
Muromonab-CD3: D05092
Otelixizumab: D08959
Teplizumab: D09013
Visilizumab: D06314
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    916 (CD3E)
   04660 T cell receptor signaling pathway
    916 (CD3E)
   04658 Th1 and Th2 cell differentiation
    916 (CD3E)
   04659 Th17 cell differentiation
    916 (CD3E)
 09160 Human Diseases
  09163 Immune diseases
   05340 Primary immunodeficiency
    916 (CD3E)
  09172 Infectious diseases: Viral
   05166 Human T-cell leukemia virus 1 infection
    916 (CD3E)
   05170 Human immunodeficiency virus 1 infection
    916 (CD3E)
   05162 Measles
    916 (CD3E)
   05169 Epstein-Barr virus infection
    916 (CD3E)
  09174 Infectious diseases: Parasitic
   05142 Chagas disease (American trypanosomiasis)
    916 (CD3E)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:hsa04090]
    916 (CD3E)
CD molecules [BR:hsa04090]
 Proteins
  916 (CD3E)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ig_5 Ig_4 ITAM Ig_3 Ig_2 P5-ATPase
Motif
Other DBs
NCBI-GeneID: 916
NCBI-ProteinID: NP_000724
OMIM: 186830
HGNC: 1674
Ensembl: ENSG00000198851
Vega: OTTHUMG00000166968
Pharos: P07766(Tclin)
UniProt: P07766
Structure
PDB: 

Position
11q23.3
AA seq 207 aa AA seqDB search
MQSGTHWRVLGLCLLSVGVWGQDGNEEMGGITQTPYKVSISGTTVILTCPQYPGSEILWQ
HNDKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYPRGSKPEDANFYLYLRARVCE
NCMEMDVMSVATIVIVDICITGGLLLLVYYWSKNRKAKAKPVTRGAGAGGRQRGQNKERP
PPVPNPDYEPIRKGQRDLYSGLNQRRI
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atgcagtcgggcactcactggagagttctgggcctctgcctcttatcagttggcgtttgg
gggcaagatggtaatgaagaaatgggtggtattacacagacaccatataaagtctccatc
tctggaaccacagtaatattgacatgccctcagtatcctggatctgaaatactatggcaa
cacaatgataaaaacataggcggtgatgaggatgataaaaacataggcagtgatgaggat
cacctgtcactgaaggaattttcagaattggagcaaagtggttattatgtctgctacccc
agaggaagcaaaccagaagatgcgaacttttatctctacctgagggcaagagtgtgtgag
aactgcatggagatggatgtgatgtcggtggccacaattgtcatagtggacatctgcatc
actgggggcttgctgctgctggtttactactggagcaagaatagaaaggccaaggccaag
cctgtgacacgaggagcgggtgctggcggcaggcaaaggggacaaaacaaggagaggcca
ccacctgttcccaacccagactatgagcccatccggaaaggccagcgggacctgtattct
ggcctgaatcagagacgcatctga

DBGET integrated database retrieval system