KEGG   Homo sapiens (human): 91624Help
Entry
91624             CDS       T01001                                 

Gene name
NEXN, CMH20, NELIN
Definition
(RefSeq) nexilin F-actin binding protein
  KO
K23918  nexilin
Organism
hsa  Homo sapiens (human)
Disease
H00294  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    91624 (NEXN)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Others
     91624 (NEXN)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: I-set Ig_3 ig Ig_2
Motif
Other DBs
NCBI-GeneID: 91624
NCBI-ProteinID: NP_653174
OMIM: 613121
HGNC: 29557
Ensembl: ENSG00000162614
Vega: OTTHUMG00000040533
Pharos: Q0ZGT2(Tbio)
UniProt: Q0ZGT2
Position
1p31.1
AA seq 675 aa AA seqDB search
MNDISQKAEILLSSSKPVPKTYVPKLGKGDVKDKFEAMQRAREERNQRRSRDEKQRRKEQ
YIREREWNRRKQEIKEMLASDDEEDVSSKVEKAYVPKLTGTVKGRFAEMEKQRQEEQRKR
TEEERKRRIEQDMLEKRKIQRELAKRAEQIEDINNTGTESASEEGDDSLLITVVPVKSYK
TSGKMKKNFEDLEKEREEKERIKYEEDKRIRYEEQRPSLKEAKCLSLVMDDEIESEAKKE
SLSPGKLKLTFEELERQRQENRKKQAEEEARKRLEEEKRAFEEARRQMVNEDEENQDTAK
IFKGYRPGKLKLSFEEMERQRREDEKRKAEEEARRRIEEEKKAFAEARRNMVVDDDSPEM
YKTISQEFLTPGKLEINFEELLKQKMEEEKRRTEEERKHKLEMEKQEFEQLRQEMGEEEE
ENETFGLSREYEELIKLKRSGSIQAKNLKSKFEKIGQLSEKEIQKKIEEERARRRAIDLE
IKEREAENFHEEDDVDVRPARKSEAPFTHKVNMKARFEQMAKAREEEEQRRIEEQKLLRM
QFEQREIDAALQKKREEEEEEEGSIMNGSTAEDEEQTRSGAPWFKKPLKNTSVVDSEPVR
FTVKVTGEPKPEITWWFEGEILQDGEDYQYIERGETYCLYLPETFPEDGGEYMCKAVNNK
GSAASTCILTIESKN
NT seq 2028 nt NT seq  +upstreamnt  +downstreamnt
atgaatgatatttcccaaaaggctgagattctgctttcttcatctaaacctgtcccaaaa
acctatgtaccaaaacttggcaagggtgatgtaaaggataagtttgaagccatgcagaga
gccagggaagaaagaaatcaaaggagatctagagacgaaaaacaaagaagaaaagaacaa
tatattagagagagagaatggaacaggagaaagcaggagattaaagaaatgcttgcttct
gatgatgaggaagatgtatcttctaaagtagaaaaggcttatgttccaaaattaacagga
actgtgaagggtagatttgctgaaatggagaaacaaagacaagaggaacaaaggaagaga
acggaggaggaacgaaaacgcagaattgagcaggatatgttagaaaagaggaaaatacag
cgtgaattagcaaaaagggctgaacagattgaggacataaacaatacgggaactgaatca
gcatcagaggaaggagatgattcactacttataactgtggtacctgtcaaatcatataaa
acatctggaaaaatgaaaaagaattttgaggatctagaaaaagaacgtgaagagaaagaa
aggatcaagtacgaggaagataaaagaataagatatgaagaacaacgaccatctctcaag
gaagcaaagtgtctttcattagttatggatgatgaaatagaaagtgaagcaaaaaaagaa
tcactttctcccggaaaattgaaactaacttttgaagaactggagcgacaaagacaagaa
aaccgaaagaagcaagctgaagaggaagcaagaaaacgtttagaagaagagaagcgtgct
tttgaagaagcaaggcggcaaatggtaaatgaagatgaggaaaaccaagacacagcaaaa
atttttaaagggtaccgccctggtaaactcaaactcagttttgaagaaatggaaaggcaa
agaagagaagatgaaaaaaggaaagcagaagaagaagccagaaggagaatagaggaagaa
aagaaggcgtttgctgaagcaaggagaaatatggtagtagatgatgactccccagagatg
tataagacaatctctcaagaatttcttacaccgggaaaactggaaattaattttgaagaa
ttattaaaacaaaaaatggaagaagaaaaacgacgaacagaggaggaacggaagcataag
ctagaaatggagaaacaagaatttgaacaactgagacaggaaatgggagaggaagaggaa
gaaaatgaaacctttggattgagcagagaatatgaagaactgatcaaattaaaaaggagt
ggctctattcaagctaaaaacctaaaaagcaagtttgaaaaaattggacagttgtctgaa
aaagaaatacagaaaaaaatagaagaagagcgagcaagaaggagagcaattgaccttgaa
attaaagagcgagaagctgaaaattttcatgaggaagatgatgttgatgttaggcctgca
agaaaaagcgaggctccatttactcacaaagtgaatatgaaagctagatttgaacaaatg
gctaaggcaagagaagaagaagaacaaagaagaattgaagaacaaaagttactacgcatg
cagtttgaacaaagggaaattgatgcagcactacaaaagaaaagagaagaggaggaggag
gaagaaggtagcatcatgaatggctccactgctgaagatgaagagcaaaccagatcagga
gctccatggttcaagaagcctcttaaaaacacatcagttgtagacagtgagccagtcaga
tttacggttaaagtaacaggagaacccaaaccagaaattacatggtggtttgaaggagaa
atactgcaggatggagaagactatcaatatattgaaaggggagaaacttactgcctttac
ttaccagaaactttcccagaagatggaggagagtatatgtgtaaagcagtcaacaataaa
ggatctgcagctagtacctgtattcttaccattgaaagtaagaattaa

DBGET integrated database retrieval system