KEGG   Homo sapiens (human): 91647
Entry
91647             CDS       T01001                                 
Symbol
ATPAF2, ATP12, ATP12p, LP3663, MC5DN1
Name
(RefSeq) ATP synthase mitochondrial F1 complex assembly factor 2
  KO
K07556  ATP synthase mitochondrial F1 complex assembly factor 2
Organism
hsa  Homo sapiens (human)
Disease
H01369  ATP synthase deficiency
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:hsa03029]
    91647 (ATPAF2)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial quality control factors
  Mitochondrial respiratory chain complex assembly factors
   Complex-V assembly factors
    91647 (ATPAF2)
SSDB
Motif
Pfam: ATP12 Ribosomal_L14e
Other DBs
NCBI-GeneID: 91647
NCBI-ProteinID: NP_663729
OMIM: 608918
HGNC: 18802
Ensembl: ENSG00000171953
Pharos: Q8N5M1(Tbio)
UniProt: Q8N5M1
Position
17:complement(18015059..18039168)
AA seq 289 aa
MWRSCLRLRDGGRRLLNRPAGGPSASMSPGPTIPSPARAYAPPTERKRFYQNVSITQGEG
GFEINLDHRKLKTPQAKLFTVPSEALAIAVATEWDSQQDTIKYYTMHLTTLCNTSLDNPT
QRNKDQLIRAAVKFLDTDTICYRVEEPETLVELQRNEWDPIIEWAEKRYGVEISSSTSIM
GPSIPAKTREVLVSHLASYNTWALQGIEFVAAQLKSMVLTLGLIDLRLTVEQAVLLSRLE
EEYQIQKWGNIEWAHDYELQELRARTAAGTLFIHLCSESTTVKHKLLKE
NT seq 870 nt   +upstreamnt  +downstreamnt
atgtggaggagctgcctccggctgcgggacgggggacgccgtctcctgaatcggccggcg
ggtggccccagcgcttctatgagtccggggccaaccatcccgtctccagcccgggcttac
gccccgccgacagaaaggaagaggttttatcagaatgtcagcatcacacagggtgaaggt
ggctttgagataaacctggaccacaggaagctgaaaactccccaagccaagctctttacc
gtccccagcgaggccctggccattgcagtggctactgagtgggattcccagcaggatacc
atcaagtactacaccatgcacctgaccacattgtgcaacacatcattggacaacccaacc
cagagaaacaaggatcagctgatccgggcagccgtgaagtttctggacaccgacaccatc
tgctacagggtggaggagcccgagacattagtggaacttcaaaggaatgagtgggatcca
atcatcgaatgggctgagaaaagatacggcgtggagatcagctcctccaccagcataatg
ggacccagcatccctgccaaaactcgggaggtgctcgtcagccacctggcatcttacaac
acatgggctttacaagggattgagtttgtagctgcccagctcaagtccatggtgctaacc
ttgggcctgattgacctgcgcctgacagtggagcaggccgtgctgctgtcacgcctggag
gaggagtaccagatccagaagtggggcaacattgagtgggcccatgactatgagctgcag
gagctgcgggcccgcaccgccgccggcaccctcttcatccatctctgctccgagagcacc
acagtcaagcacaagctcctgaaggagtga

DBGET integrated database retrieval system